Кд 34: Проект каркасного дома КД-34 комфорт / каркасный дом своими руками

Содержание

Проект каркасного дома КД-34 комфорт / каркасный дом своими руками

Цена дома с утеплением 200мм мин. ваты и отделкой 811т.р.
Цена дома с утеплением 200мм мин. ваты, отделкой и фундаментом 923т.р.
Цена дома с утеплением 200мм мин. ваты, отделкой, фундаментом, электрикой, сантехникой и водоснабжением 996т.р.
Стандартное утепление пол/стены 200мм и 250мм крыша базальтовой мин. ваты, максимально 250-300мм.
Цена проекта для самостоятельной сборки 10,9т.р. Заказать проект. Скачать смету и читать подробнее...

Если по каким-то причинам, вы не хотите или не можете сами построить дом по нашему проекту, то мы можем сделать всё это за вас, причём недорого и в кратчайшие сроки, подробнее о ценах и преимуществах строительства под ключ, читайте в разделе "Цена под ключ".

Каркасный дом одноэтажный


Скачать, Проект КД-34 (комфорт) 0.47 Мб (pdf) >>> подробное описание.

Чертежи каркасного дома 7,5х10,5м - компактный, очень комфортный и тёплый дом для постоянного или сезонного проживания с тремя спальнями. С большой террасой в половину дома на входе. В доме есть всё необходимое для проживания, котельная где можно установить и стиральную машину, ванная где можно установить небольшую ванну как на планировке, угловую, или большую вдоль стены с котельной. При желании, кухню можно сделать на месте спальни детской и будет огромная гостиная. Такой дом вы можете построить сами, своими руками по нашим чертежам или нашими силами.

Отделка дома может быть изменена под ваши предпочтения, по проекту: наружная предчистовая отделка ОSB, внутренняя ГКЛ и кровля Ондулин входят в стоимость проекта. Также, в цену проекта включён фундамент на выбор (лента, сваи, лента-плита), утепление стен/пол 200мм, потолок 250мм мин. ваты (возможно до 250 и 300мм соответственно), электропроводка и установочные изделия, автоматика, водоснабжение и канализование с сантехникой.

Дом в один этаж 78м2 : Высота потолков 2,7м, Спальни 2 по 10,5м2, Спальня детская 8,4м2, Кухня/гостиная 24,5м2, Прихожая 3,6м2, с/у 3,4м2, Котельная 4,5м2, Холл 3м2, Терраса 10м2, высота в коньке 4,75м (5,25м).

Похожие проекты: КД-33 и КД-3 и КД-35
и КД-37 и КД-38 или КД-42 и КД-47 и КД-45 и КД-49 и КД-4

Для увеличения картинки нажмите на неё.

1. Вариант стандартный.

Варианты внешнего вида:
возможна любая отделка, см. варианты, проект КД-3 и КД-31.

Высотные отметки:

Фундамент для этого дома:
по проекту МЗЛФ 50в х 40ш.
возможны сваи (винтовые, забивные, буронабивные и т.д.) 28 шт.
к сваям можно заказать обвязку из пакета досок 200*50мм 3шт на ребро.

Кликнув по фотографиям ниже, вы сможете посмотреть фотогалереи домов, построенных по данному проекту нашими строителями или самостоятельно заказчиками (см. прим. в галереях):

Также, смотрите видеоэкскурсии по построенным домам Karkasdom.info.

Заказ проекта

Для того, чтобы оформить заказ, выберите тип фундамента и другие возможные опции, затем нажмите кнопку "Заказать проект". В открывшейся форме укажите правильно Ваш email и другие необходимые данные (полный адрес, включая индекс, город, улицу, дом и т.д.). Если заказ оформлен верно, то после обработки заказа нашим специалистом, в течении дня, к вам на почту поступит подтверждение заказа с уточнением деталей и вариантами оплаты.

Если по истечению суток ответ Вам так и не поступил, проверьте папку нежелательных писем или спам, если ответа нет, можете позвонить узнать, что с вашим заказом или сделать повторную заявку. Заказчики часто неверно указывают почту и письма не доходят до адресата.

Проект КД-34


Выбрать вариант фундамента:

Лента (МЗЛФ)СваиСваи с пакетом досок +1тр


Цена проекта 10,9т.р.
(комплект рабочих схем и узлов: каркасный дом, фундамент, инженерия электрика, смета и т.д.)

Заказать проект

Частые вопросы клиентов:

Что делать, если надо что-то поменять в понравившемся проекте?

Незначительную доработку проекта под вас мы сделаем бесплатно.

Если мне не подходит ни один проект, что делать?

Мы можем сделать индивидуальный проект, но это займёт примерно месяц и будет несколько дороже стандартного проекта.

Возможно, внести изменения в предложенную комплектацию и смету?

Да, конечно, проект не привязан жёстко к указанным там маркам материалов, по своему желанию, вы можете выбрать более дорогие или более бюджетные материалы, главное сохранить конструктив и технологию строительства по самому проекту. В смете к проекту содержатся пояснения по возможной замене материалов.

Какие возможны варианты стенового материала и утепления в этой комплектации?

Доска обрезная: стены и часть перегородок 150х50мм, утепление минеральная вата базальтовых пород 150мм, плюс 50мм горизонтально, пол 200мм, крыша 250мм, макс. 250-300мм.

Какую толщину стен выбрать?

Для того чтобы правильно выбрать толщину стен, необходимо определиться с целевым использованием дома и регионом его строительства.

В доме для постоянного проживания с газовым отоплением: толщины стены в 150мм будет вполне достаточно. Для комфортного проживания и зимой, и летом рекомендуем утепление 150мм между стоек, плюс 50мм горизонтально со стороны дома. Если дом планируется как летний или гостевой: толщины стены и утеплителя в 150мм между стоек вполне достаточно.

Необходимость утепления

Утепление дома в разы повышает его энергосберегающие показатели. Например, утеплив дом 150мм между стоек, плюс по 50мм горизонтально со стороны улицы и дома, в нем уже можно будет проживать круглый год, и разумно использовать другие источники энергии, в том числе и электричество.

Мы в своих проектах предлагаем различные варианты утепления, в зависимости от заявленных требований к энергосбережению, это может быть утепление: фундамента, отмостки, дополнительное утепление дома снаружи, к существующим 150-200мм ещё плюс 50-100мм.

Назад в раздел, Проекты каркасных домов

Проект каркасного дома КД-34 | СК Формула Дома

1 2 3 4 5 6 7 8 9 10 11 12 13 14

1Фундамент - Фундамент в базовую комплектацию не входит и рассчитывается отдельно.

2Ростверка (обвязка) - Брус 100х150 мм. Между первым рядом обвязки и фундаментом прокладывается рубероид.

3Полы 1 этажа - Лаги из бруса 50х150 мм. Утепление 150 мм. Чистовой пол – OSB. Парогидроизоляция с двух сторон.

4Перекрытия 1 этажа - Балки из бруса 50х150 мм. Утепление 150 мм. Потолок-OSB. Парогидроизоляция с двух сторон.

5Стены - Брус 50х150 мм. Утепление 150 мм. Отделка снаружи-Имитация бруса, отделка внутри-OSB. Контр-обрешетка наружная. Парогидроизоляция с двух сторон.

6Перегородки - Брус 50х150 мм. Утепление 150 мм. Отделка OSB. Парогидроизоляция с двух сторон.

7Мансарда (при наличии) - Брус 50х150 мм. Утепление 150 мм. Внутренняя отделка OSB. Парогидроизоляция с двух сторон

8Фронтоны - Брус 50х150 мм. Утепление 150 мм. Отделка снаружи-Имитация бруса, тделка внутри-OSB. Контр-обрешетка наружная. Парогидроизоляция с двух сторон.

9Стропильная система - Брус 50х150 мм.

10Кровля - Металлочерепица, доборная система.

11Окна - Пластиковые, с пятикамерным профилем, отливы под окнами из листовой стали.

12Дверь входная - Металлическая дверь (пр-во Россия) с ручками и 2-мя замками.

13Лестница - Одномаршевая или двухмаршевая (по проекту) без перил и балясин. Ширина лестницы 600 мм. Угол наклона определяется в зависимости от проекта

14Терраса - Устанавливаются опорные столбы (без ограждения).Потолок на террасе-OSB. Пол – OSB.

Проектирование 1 фото Разработка рабочих и сборочных чертежей, 3d-проекции, спецификации стеновых элементов.
Геодезические работы 1 фото Разбивка осей, нивелировка
Фундамент 4 фото Фундамент в базовую комплектацию не входит и рассчитывается отдельно. На выбор заказчика: Опорно-столбчатый, свайно-винтовой, монолитная плита, фундамент на забивных железобетонных сваях.
Ростверк 2 фото Брус 100х150 мм. Между первым рядом обвязки и фундаментом прокладывается рубероид.
Полы 1 этажа 5 фото Лаги из бруса 50х150 мм. Утепление 150 мм. Чистовой пол – OSB. Парогидроизоляция с двух сторон.
Перекрытия 1 этажа 3 фото Балки из бруса 50х150 мм. Утепление 150 мм. Потолок-OSB. Парогидроизоляция с двух сторон.
Стены 6 фото Брус 50х150 мм. Утепление 150 мм. Отделка снаружи-Имитация бруса, отделка внутри-OSB. Контр-обрешетка наружная. Парогидроизоляция с двух сторон.
Перегородки 4 фото Брус 50х150 мм. Утепление 150 мм. Отделка OSB. Парогидроизоляция с двух сторон.
Мансарда (при наличии) 5 фото Брус 50х150 мм. Утепление 150 мм. Внутренняя отделка OSB. Парогидроизоляция с двух сторон
Фронтоны 3 фото Брус 50х150 мм. Утепление 150 мм. Отделка снаружи-Имитация бруса, тделка внутри-OSB. Контр-обрешетка наружная. Парогидроизоляция с двух сторон.
Стропильная система 4 фото Брус 50х150 мм.
Кровля 5 фото Металлочерепица, доборная система.
Окна 4 фото Пластиковые, с пятикамерным профилем, отливы под окнами из листовой стали.
Дверь входная 2 фото Металлическая дверь (пр-во Россия) с ручками и 2-мя замками.
Лестница (при наличии) 2 фото Одномаршевая или двухмаршевая (по проекту) без перил и балясин. Ширина лестницы 600 мм. Угол наклона определяется в зависимости от проекта
Терраса( при наличии) 3 фото Устанавливаются опорные столбы (без ограждения).Потолок на террасе-OSB. Пол – OSB.
Крепежи 4 фото Гвозди (чёрные) - для скрытых частей дома, гвозди оцинкованные для внутренней и наружней отделки, скобы, ленты.
Огнебиозащита 1 фото Комплексная огнебиозащита лаг,черновых полов,силового каркаса, стропильной системы.
Сборка
4 фото
Сборка дома квалифицированной бригадой (россияне) входит в стоимость.
Контроль 2 фото Тех. надзор по контролю качества материала и монтажных работ.
Гарантия 1 фото 3 года.
Допустимая нагрузка на пол до 200кг/кв.м
Комфортное нахождение при температуре - 15 до +30
Скидка до 5% на все последующие дополнительные услуги

Одноэтажный каркасный дом 8х6 с мансардой, террасой, дормером по проекту «КД-34», стоимость строительства от 1452000 руб.

Фундамент В стоимость не входит. Рассчитывается отдельно.
Высота 1-го этажа 2,50м. (допуски по высоте: +\-50 мм).
Высота 2-го этажа 2,30м. (допуски по высоте: +\-50 мм).
Основание Двойное. Конструируется из бруса 150х150мм. – естественной влажности.
Половые лаги Из бруса 150х40мм. - естественной влажности, на ребро, с шагом 590мм.
Черновой пол Не строганная, обрезная доска 100х20мм. – естественной влажности «класс В»
Чистовой пол 1го и 2го этажа Строганная шпунтованная доска толщиной 36мм. +\- 2мм. - камерной сушки.
Утепление пол, потолок Минеральная вата рулонного типа «Кнауф» 150мм Ветровлагоизоляция и парогидроизоляция «Изоспан».
Силовой каркас и фронтоны Каркас выполняется из бруса 150х40мм - естественной влажности, шагом 590мм Ригеля и укосины из бруса 150х40мм - естественной влажности. С уличной стороны монтируется контр рейка из не строганной, обрезной доски 50х20мм – естественной влажности «класс В». Ветровлагозащита «Изоспан А», каркас обшивается с уличной стороны: Имитаций Бруса - камерной сушки «класс В». С внутренней стороны монтируется парогидроизоляция «Изоспан В». Каркас обшивается с внутренней стороны: вагонкой - камерной сушки «класс В». Утепление «Роквул Лайт Батс Скандик» - 150мм Плотность не ниже 37 кг/м3.
Перегородки каркасно-щитовые конструируются из бруса 100х40мм - естественной влажности, с шагом 590мм. Ригеля и укосины из бруса 100х40мм. - естественной влажности. С обеих сторон монтируется «Изоспан В». Каркас обшивается: вагонкой - камерной сушки «класс В». Утепление «Роквул Лайт Батс Скандик» - 100 мм Плотность не ниже 37 кг/м3.
Межэтажное перекрытие конструируется из бруса 150х40мм - естественной влажности, на ребро, с шагом 590мм.
Потолок обшивается: вагонкой - камерной сушки «класс В»
Стропила изготавливаются из бруса 150х40мм. - естественной влажности, на ребро, с шагом 590мм
Обрешётка Конструируется из не строганной, обрезной доски 100х20мм. – естественной влажности «класс В», с шагом не более 200-300мм.
Каркас мансарды конструируется из бруса 150х40 мм - естественной влажности. Утепление «Роквул Лайт Батс Скандик» - 150мм. Плотность не ниже 37 кг/м3. Монтируется пароизоляция «Изоспан В». Обшиваются изнутри комнаты потолок и стены горизонтально: вагонкой - камерной сушки «класс В».
Фронтоны Устанавливаются вентиляционные решётки.
Поднебесники обшиваются снаружи вагонкой – камерной сушки «класс В». Ширина одного поднебесника составляет не менее 450мм.
Высота конька 3,5м. (допуски по высоте +\- 150мм).
Кровля Металлочерепица «Цвет на выбор». С контр рейкой из не строганной, обрезной доски 50х20мм. – естественной влажности «класс В».
Двери Входная металлическая (Россия) 2.05х0.86 м. Межкомнатные филёнчатые 2.05х0.86м. Отделка наличником. Установка с монтажной пеной.
Окна деревянные одностворчатые 2-го остекления. Отделка наличником. Установка с монтажной пеной.
Лестница одномаршевая, деревянная с перилами и точёными балясинами. Тетива выполняется из бруса 100х150мм. Ступеньки 200х40мм. Впиливаются в тетиву. Угол наклона определяется по месту и согласовывается с Заказчиком.
Плинтус хвойный. Прибивается на стыки углов стен, потолка и пола.
Углы Зашиваются вагонкой - камерной сушки «класс В»
Терраса и балкон (если предусмотрена проектом) Устанавливаются вертикальные строганные опорные столбы 100х100мм. Монтируются перила и резные балясины с шагом через одну.
Свайно винтовой фундамент
Ленточно армированный фундамент 300х700мм
Дополнительное окно с установкой 4 000 руб
Замена деревянного окна на стеклопакет (пластик) 6 000 руб
Дополнительная филенчатая дверь 4 000 руб
Обработка основания, лаг, черновых полов огнебиозащитным антисептиком
Покраска (обработка) дома с наружной стороны (Пинотекс)
Туалет каркасно – щитовой 1.2х1.0 9 000 руб
Бытовка для проживания бригады – 2.3х3.0 25 000 руб
Аренда генератора на весь срок строительства (бензин заказчика) 12 000 руб

О проекте

Одноэтажный каркасный дом по проекту «КД-34» от СК Пестово. Характеристики: 8 на 6 м, площадь - 82 кв.м. Конструктивные особенности: мансарда, терраса, дормер.

Этот каркасный дом площадью 82 кв. м имеет оригинальный дизайн, главным акцентом которого является двускатная кровля с мансардным окном кукушкой. Войти в дом можно через террасу, там вас ждет просторный холл, куда выходят двери спальни и гостиной. Имеется также просторная кухня- столовая с двумя окнами. Двухмаршевая лестница ведет вверх, в мансарде располагаются две изолированных спальни с дверями, выходящими в холл. Кровельное покрытие – металлочерепица, расцветка на выбор заказчика, стеклопакеты двойные, изготовлены из древесины, входные двери стальные, внутренние – деревянные.

Читать дальше

Отзывы о нашей работе

Также вас могут заинтересовать другие проекты нашей компании

↑ Вверх

У НАС ВСЕ ПО-ЧЕСТНОМУ!


Оставьте телефон - и получи 5 подарков!

заявка еще не отправлена

УЗНАТЬ РАЗМЕР СКИДКИ

Каркасный дом КД-34 - dacha

Материалы и монтаж

Каркас со сборкой
(под крышу)

«Теплый контур»
(отделка и утепление)

Стоимость комплектацииПо запросу1 750 000 руб
Сборка на участке
Доставка и разгрузка материалов 30 км от Екатеринбурга
Обвязка основания (ростверк)
Пакет из трех сшитых досок 46х195мм (138х195мм). Обработка ростверка/лежни доски антисептиком «Ултан»
Силовой каркас стен
Наружные и внутренние стены — доска сухая 45х145 и 45х95мм
Врезные диагональные укосины (плитная обшивка ОСП-12мм по согласованию)
Обвязочный верхний пояс — доска сухая 45х145мм
Пол первого этажа
Лаги — доска сухая 45х195мм. Шаг 500мм
Пол второго этажа или перекрытия
Лаги — доска сухая 45х195мм. Шаг 500мм/600мм
Крыша
Стропильная система — доска сухая 45х145мм
Контробрешетка из бруска сух. 45х45мм
Обрешетка из сухой доски 20х145мм
Гидроизоляция — мембрана  DELTA-NEO VENT
Проклейка швов скотч DELTA®-MULTI-BAND
Кровельное покрытие — металлочерепица монтеррей -0,5мм, конек, торцевые планки, кровельные саморезы
Настил полов
Фанера 18мм, пароизоляция, подшив снизу лаг ОСП-9мм. Сборка по системе платформа (только зимой) 
Окна и двери
Окна ПВХ «REHAU», пятикамерный профиль — 70 мм, фурнитура ROTO_NT, двухкамерный стеклопакет, подоконники. (площадь остекления по согласованию) 
Входная термостойкая дверь JELD-WEN (Финлятдия) с цилиндром ABLOY, ручка дверная POLAR.  Теплопроводность U≤0,7 W/Km2 
Утепление
Внешние стены 150мм «Кнауф» 
Внутренние стены шумоизоляция 100мм «Кнауф» 
Пол первого этажа — 200мм «Кнауф» 
Межэтажное перекрытие — 150мм «Кнауф» 
Потолок/мансардный этаж — 200мм «Кнауф» 
Внутренняя отделка
Стены и потолки гипсокартон 12,5мм «Knauf» 
Пароизоляция 200МКР гост, с проклейкой швов Delta 
Крепеж
Гвозди для нейлера — 90; 75; 50мм, метизы, саморезы на ленте для ГКЛ, саморезы для плитной обшивки, пластины, шпильки резьбовые
Варианты наружной отделки дома  (материалы и монтаж)
Фасад — сайдинг виниловый «Docke»от 1100р/м2
Фасад — сайдинг металлическийот 1500р/м2
Имитация бруса сосна (18*135мм) окрашенная на заводеот 2000р/м2
Фиброцементный сайдинг CEDRALот 3000р/м2
Мокрый (штукатурный) фасад с утеплением 50ммот 1500р/м2
Подшив карнизов софитамиот 1200р.м.п.
Водосточная системаот 1100р.м.п.

Каркасный дом КД-34

Высота потолка 1-го этажа

2,50 м.± 5 см.

Высота потолка 2-го этажа

2,40 м.± 5 см.

Обвязочный венец

(подкладной брус)

Из нестроганного бруса 100х150 мм

(естественной влажности)

Половые лаги 1 и 2 этажей

Обрезная доска 50х150 мм (с шагом 60 см)

(естественной влажности)

Черновой пол

Обрезная доска 20х100 мм

(естественной влажности)

Каркас стен (стойки, пояса, диагональные укосины, ригели)

Обрезная доска 50х100 мм (шаг вертикальных стоек 60 см)

(естественной влажности)

Каркас перегородок (стойки, пояса, диагональные укосины, ригели)

Обрезная доска 50х100 мм (шаг вертикальных стоек 60 см)

(естественной влажности)

Стропильная система

Обрезная доска 50х100 мм (с шагом 60 см)

(естественной влажности)

Контробрешётка кровли

Брусок 20х50 мм

(естественной влажности)

Обрешётка кровли

Обрезная доска 20х100 мм (с шагом 30-35 см)

(естественной влажности)

Ветровлагозащита кровли

«Изоспан C» (или аналог)

Кровельное покрытие

Ондулин. Цвет на выбор (красный, зелёный, коричневый)

Поднебесники и карнизы

(свесы кровли)

Вагонка хвойных пород класса «В» толщ 14-16 мм

(естественной влажности)

 

Ширина свесов кровли 40-50 см

Утепление наружных стен

Базальтовая вата (в плитах) «ROCKWOOL Лайт Баттс Скандик» (или аналог) тощиной 100 мм

 

Утеплитель прокладывается с двух сторон гидро-, пароизоляцией «Изоспан А» и «Изоспан В» (или аналог)

Утепление пол 1-го этажа

Минеральная вата (в рулонах) «KNAUF» (или аналог) толщиной 100 мм

 

Утеплитель прокладывается с двух сторон гидро-, пароизоляцией «Изоспан А» и «Изоспан В» (или аналог)

Утепление межэтажного перекрытия

(звукоизоляция)

Минеральная вата (в рулонах) «KNAUF» (или аналог) толщиной 50 мм

 

Утеплитель прокладывается с двух сторон пароизоляцией «Изоспан В» (или аналог)

Утепление перегородок

(звукоизоляция)

Не предусмотрено

Утепление потолка 2-го этажа

Минеральная вата (в рулонах) «KNAUF» (или аналог) толщиной 100 мм

 

Утеплитель прокладывается с двух сторон пароизоляцией «Изоспан В» (или аналог)

Наружная отделка стен

Имитация бруса 17х135(140) мм хвойных пород

(камерной сушки)

 

Выполняется вентилируемый фасад: наружная отделка стен выполняется по контрбруску 40х50 мм

(естественной влажности)

Внутренняя отделка стен и перегородок

Евровагонка хвойных пород класса «В» толщ 12,5 мм

(камерной сушки)

Чистовая отделка полов

Половая шпунтованная доска толщ 28 мм

(камерной сушки)

Чистовая отделка потолков

Евровагонка хвойных пород класса «В» толщ 12,5 мм 

(камерной сушки)

Двери

Входная дверь – каркасная наборная из вагонки, утеплённая

 

Межкомнатные двери – филенчатые

 

Размеры и количество согласно эскизному проекту

Окна

Деревянные двойного остекления (имитация стеклопакетов), открывающиеся, с фурнитурой

 

Размеры и количество согласно эскизному проекту

Отделка дверных и оконных проёмов

Наличники хвойных пород

(камерной сушки)

Отделка углов внутренних помещений

Плинтус хвойных пород

(камерной сушки)

Лестница

Выполнена из сухой строганной доски (в комплекте: тетива ширина 200 мм, ступени ширина 200 мм, перила, точеные балясины, стартовые столбы)

Терраса/крыльцо/балкон

(если есть)

Стойки выполнены из строганного бруса, ограждение (перила и балясины) из строганного материала

 

Настил пола - террасная доска хвойных пород 40х100 мм

(естественной влажности)

 

Подшивка потолка - вагонка хвойных пород класса «В» толщ 14-16 мм

(естественной влажности)

Обработка силового каркаса дома

Огнебиозащита «Neomid» (или аналог)

Внесение изменений в проект/план дома

Возможно

Внесение изменений в комплектацию дома

Возможно

Каркасный дом площадью 74,5 м2 "КД-34"

1 Фундамент Изготавливается из песко-цементных блоков размером 200х400х200 мм., по 6 блоков в каждой тумбе. Тумбы выставляются по периметру стен и под несущими перегородками расстоянии от 1,5 до 2,0 метров друг от дуга. Стоимость фундамента включена в стоимость дома
2 Основание дома Брус сечением 150х100 мм.
3 Стены Каркасно-щитовые, из бруска 100х40 мм. (при толщине утеплителя 150 мм. брусок 150х40 мм.), крепление на гвозди Каркасно-щитовые, из бруска 150х40 мм. с дополнительной обрешёткой бруском 50х50 мм., крепление на гвозди
4 Лаги пола Брус сечением 150х100 мм. через 60-70 см. Брус сечением 200х50 мм.. через 60-70 см.
5 Черновой пол Обрезная доска толщиной 20 мм.
6 Перегородки Каркасно-щитовые, из бруска 100х40 мм. (крепление на гвозди) Каркасно-щитовые, из бруска 150х40 мм., крепление на гвозди, с утеплением 150 мм. (KNAUF)
7 Стропила Брус 40х100 мм. через 100 см. Брус сечением 200х50 мм. через 100 см.
8 Обрешетка кровли Обрезная доска толщиной 20 мм. через 20-30 см.
9 Отделка стен снаружи Вагонка естественной влажности, класса "В", 12-14 мм.
10 Фронтоны, свесы Обшиваются вагонкой естественной влажности класса "В"
11 Кровельное покрытие Ондулин зелёного, красного, коричневого цветов
12 Утепление дома Рулонные маты ISOVER/KNAUF 50 мм./100 мм./150 мм. Рулонные и плитные маты ISOVER/KNAUF 200 мм.
13 Пароизоляция пола, потолка, стен Паропроницаемая мембрана Изоспан
14 Чистовой пол Шпунтованная сухая половая доска толщиной 28 мм. Шпунтованная сухая половая доска толщиной 36 мм.
15 Высота потолка В чистоте: 1-ый этаж – 245 см., 2-ой этаж – 230 см. (+/- 5 см.)
16 Отделка внутренних стен и потолка Сухая вагонка класса "В", 12-14 мм.
17 Окна – 1,0х1,2 м. Деревянные двойного остекления с одной открывающейся фрамугой, с фурнитурой (количество согласно проекту)
18 Двери 0,8х1,8 м. (ширина и высота) Входная – металлическая с личиной. Внутренние – деревянные филенчатые, без фурнитуры (количество согласно проекту)
19 Отделка плинтусом Все внутренние углы садового дома закрываются деревянным плинтусом

34 - 45900 . Ļ

-34 - 45900 . Ļ -34 :
    • 5025

    • 164

    • 4025

    • 2

    • и 2 .

    • - + ; -

    • Ø 25 (3 )

    • "" 4-

    • "" 4-

    • 200

    • / ( )

    • 180

    • ( ) +


  • :

    • 500 .

    • 1000 .

    • 100 . 1

    • 600 .

    • ( ) 1400 .

    • 1000 .


    • 25


    • 25 1100 .

    • 3000 .

    • 1000 .

    • 1100 .

CD34 - обзор | Темы ScienceDirect

Циркулирующие CD34

+ (KDR + ) Эндотелиальные клетки-предшественники

Другой метод, используемый для идентификации EPC, - это обнаружение циркулирующих клеток по экспрессии их поверхностных маркеров с помощью проточной цитометрии.

Клетки CD34 + можно выделить из периферической крови человека с помощью сортировки клеток с помощью магнитных шариков. Мертвые клетки исключаются с помощью йодида пропидия, а возможные контаминирующие моноциты исключаются путем исключения клеток CD14 + .Затем клетки инкубируют с моноклональными антителами против внеклеточных частей VEGFR-2 или CD133. Гранулоцитарный колониестимулирующий фактор (G-CSF) можно использовать для стимуляции мобилизации клеток CD34 + из костного мозга (от 0,4% до 2,0% популяции CD34 + ) для повышения чувствительности измерения. Другие группы [21] использовали периферическую кровь непосредственно с моноклональными антителами, в результате чего количество циркулирующих PBMC составило 0,03%.

Во время анализа сортировки клеток с активацией флуоресценции (FACS) циркулирующие клетки-предшественники характеризуются как клетки, расположенные в воротах лимфоцитов (на основе разброса в прямую сторону) и экспрессирующие CD34 + и CD45 dim .Некоторые исследовательские группы также добавляют присутствие рецептора VEGF-2 / KDR или маркера стволовых клеток CD133 для дальнейшей характеристики предшественников. Принято выражать количество клеток CD34 + на 10 3 лейкоцитов CD45 + .

Многочисленные исследования показали корреляцию между измеренными таким образом циркулирующими клетками CD34 и риском сердечно-сосудистых заболеваний. Кроме того, большинство форм почечной недостаточности связано с уменьшением количества этих клеток (Таблица 10.1). Однако сомнительно, что такое снижение количества также отражает снижение восстановления сосудов.Очевидно, что клетки CD34 + , примированные in vitro факторами роста эндотелиальных клеток, обладают проангиогенными эффектами. Однако менее ясно, могут ли наивные клетки CD34 + спасти ишемию in vivo.

Таблица 10.1. Клинические исследования с EPC при хронической почечной недостаточности

EPC type Контекст Показания Результаты Улучшено Ref.
Миелоид HD Количество колоний, миграционная способность ↓ колоний, положительная корреляция с kT / V VEGF улучшает миграционную способность [22]
KTx Количество колоний культивировано с сывороткой пациентов Еще колонии с сывороткой из трансплантата с CrCl & gt; 50 мл / мин [23]
ESRD Количество колоний ↓ колоний 8 недель rhEPO [24]
ESRD Количество колоний от пациентов и культивированных с сыворотка пациентов ↓ колонии при ESRD или сыворотке с ESRD HD [25]
ESRD Количество колоний и ангиогенные свойства ↓ колоний, уменьшение образования пробирок Ухудшается HD [ 26]
KTx Количество колоний, анализ миграции Улучшение миграционной способности KTx [27]
ESRD CD14 + Количество EPC Незначительное увеличение со снижением в СКФ [28]
CD34 + ESRD Периферийное количество CD34 + KDR 9000 3 + CD34 + KDR + увеличивается с рСКФ [29]
KTx Периферийное количество CD34 + Уменьшается ESRD по сравнению с KTx [23]
ESRD Периферийное количество CD34 + Кратковременное увеличение при rhEPO rhEPO [24]
ESRD Периферийное количество CD34 + Снижение циркулирующих клеток HD [25]
ESRD Периферийное количество CD34 + KDR + CD34 + KDR + уменьшилось в количестве EPO [26]
KTx 900 Периферийное количество CD34 + , CD34 + KDR + и CD34 + CD133 + CD34 + an d CD34 + Число CD133 + уменьшилось KTx [27]
ESRD Периферическое количество CD34 + Число уменьшилось с возрастом, уровнем мочевины и Pi HD, статины [28]
HD Периферийное количество CD34 + Сниженное количество по сравнению со здоровым контролем и геномное повреждение Сразу после сеанса HD [30]
HD Периферийное количество CD34 + Пониженное количество коррелирует со значениями ПТГ и фосфатов [31]

EPC: эндотелиальная клетка-предшественник; HD: гемодиализ; KTx: трансплантация почки; ХПН: терминальная стадия почечной недостаточности; рСКФ: расчетная скорость клубочковой фильтрации; ЭПО: эритропоэтин; Pi: фосфатемия; ПТГ: паратироидный гормон; VEGF: фактор роста эндотелия сосудов.

В соответствии с этим, клинические исследования в области кардиологии, в которых использовались мононуклеарные клетки костного мозга или клетки CD34 + , до сих пор не показали однозначного влияния на восстановление после ишемического повреждения. Одно из объяснений того, почему циркулирующие клетки CD34 + таким надежным образом отражают сердечно-сосудистый риск, может быть связано с мобилизацией клеток CD34 + из костного мозга, которая, по-видимому, является механизмом, зависимым от eNOS. Aicher et al. продемонстрировали, что рекрутирование гемопоэтических стволовых клеток из костного мозга нарушено у мышей с нокаутом eNOS [32].На систему eNOS влияют многие факторы риска сердечно-сосудистых заболеваний. Это особенно верно в отношении уремии, где длинный список факторов, включая повышенные уровни асимметричного диметиларгинина (ADMA), цитокинов, гипертензию и нарушение толерантности к глюкозе, снижает доступность оксида азота (NO). Другой вопрос для обсуждения в отношении циркулирующей популяции CD34 + заключается в том, будет ли коэкспрессия рецептора киназного домена (KDR) отражать подтип, который, как предполагается, участвует в репарации эндотелия.Однако недавние эксперименты в этой лаборатории показывают, что рецептор VEGF-2 / KDR может экспрессироваться всеми клетками CD34 + при условии, что они столкнулись с богатой тромбоцитами стенкой поврежденного сосуда и напряжением сдвига [33]. Следовательно, экспрессия KDR может быть отражением сосудистого повреждения и, вероятно, не отражает функциональное предназначение в костном мозге.

Доказательства CD34 как общего маркера различных предшественников

Стволовых клеток. 2014 июн; 32 (6): 1380–1389.

Laura E Sidney

a Академическая офтальмология, отделение клинической неврологии, Университет Ноттингема, кампус Королевского медицинского центра, Ноттингем, Соединенное Королевство

Филиал Мэтью Дж.

a Отделение клинической неврологии университета of Nottingham, Queen's Medical Center Campus, Ноттингем, Соединенное Королевство

Siobhán E Dunphy

a Академическая офтальмология, Отдел клинической неврологии, Университет Ноттингема, кампус Медицинского центра Квинс, Ноттингем, Соединенное Королевство

b и доставки лекарств, Фармацевтический факультет Ноттингемского университета, Ноттингем, Соединенное Королевство

Harminder S Dua

a Академическая офтальмология, Отдел клинической неврологии, Университет Ноттингема, кампус Медицинского центра Королевы, Ноттингем, Соединенное Королевство

Эндрю Хопкинсон

а переменного тока адемическая офтальмология, Отдел клинической неврологии, Университет Ноттингема, Кампус Медицинского центра Королевы, Ноттингем, Соединенное Королевство

a Академическая офтальмология, Отдел клинической неврологии, Университет Ноттингема, Кампус Медицинского центра Королевы, Ноттингем, Соединенное Королевство

b Тканевая инженерия и доставка лекарств, Фармацевтический факультет, Ноттингемский университет, Ноттингем, Соединенное Королевство

Для переписки: Эндрю Хопкинсон, доктор философии, академическая офтальмология, отделение клинической неврологии, Ноттингемский университет, кампус Королевского медицинского центра, Ноттингем, NG7 2UH, Великобритания.Телефон: + 44-115-8231-014. Факс: + 44-115-9709-963; Электронная почта: [email protected]

Поступила в редакцию 30 сентября 2013 г .; Принято 15 января 2014 г.

Copyright © 2014 Авторы. СТВОЛОВЫЕ КЛЕТКИ, опубликованные Wiley Periodicals, Inc. от имени AlphaMed Press

. Это статья в открытом доступе в соответствии с условиями лицензии Creative Commons Attribution License, которая разрешает использование, распространение и воспроизведение на любом носителе при условии правильного цитирования оригинальной работы.

Эта статья цитируется в других статьях в PMC.

Abstract

CD34 представляет собой трансмембранный фосфогликопротеин, впервые идентифицированный на гемопоэтических стволовых и клетках-предшественниках. Клинически это связано с отбором и обогащением гемопоэтических стволовых клеток для трансплантации костного мозга. Из-за этих исторических и клинических ассоциаций экспрессия CD34 почти повсеместно связана с гематопоэтическими клетками, и распространено заблуждение, что CD34-положительные (CD34 + ) клетки в негематопоэтических образцах представляют собой гематопоэтическую контаминацию.Преобладающая школа мысли утверждает, что мультипотентные мезенхимальные стромальные клетки (МСК) не экспрессируют CD34. Однако убедительные доказательства демонстрируют, что CD34 экспрессируется не только МСК, но и множеством других негематопоэтических типов клеток, включая мышечные сателлитные клетки, кератоциты роговицы, интерстициальные клетки, эпителиальные предшественники и предшественники эндотелия сосудов. Во многих случаях клетки CD34 + составляют небольшую долю от общей популяции клеток, а также указывают на отдельную подгруппу клеток с повышенной активностью предшественников.Здесь мы исследуем общие черты между клетками, которые экспрессируют CD34, включая ассоциированные маркеры, морфологию и потенциал дифференцировки. Мы стремимся выделить ключевые сходства между клетками CD34 + , уделяя особое внимание активности предшественников. Общая функция CD34 еще предстоит выяснить, но, анализируя и понимая связи между клетками CD34 + , мы надеемся, что сможем предложить понимание перекрывающихся свойств клеток, экспрессирующих CD34. Стволовые клетки 2014; 32: 1380–1389

Ключевые слова: CD34, стволовые клетки, предшественники, мезенхимальные, стромальные, эпителиальные, эндотелиальные

Введение

CD34 преимущественно рассматривается как маркер гемопоэтических стволовых клеток (HSC) и клетки-предшественники.Однако в настоящее время CD34 также установлен как маркер нескольких других негематопоэтических типов клеток, включая предшественников эндотелия сосудов 1 и эмбриональных фибробластов 2 . Накапливающиеся данные демонстрируют экспрессию CD34 на нескольких других типах клеток, включая мультипотентные мезенхимальные стромальные клетки (МСК), интерстициальные дендритные клетки и эпителиальные предшественники 3 - 6 , но остается ограниченное признание роли CD34-положительных ( CD34 + ) клетки вне каждой отдельной специальности.Несмотря на постоянные доказательства экспрессии многих типов клеток, все еще существует неправильное представление о том, что CD34 представляет собой клетку гематопоэтического происхождения, и экспериментально клетки CD34 + часто рассматриваются как гематопоэтические контаминации и впоследствии игнорируются.

В этом обзоре представлены доказательства, подтверждающие, что CD34 является общим маркером клеток-предшественников. Мы исследуем общие черты, такие как экспрессия маркеров, морфология и потенциал дифференцировки, и пытаемся привлечь внимание к множеству разнородных типов клеток, экспрессирующих CD34, и в процессе выявить ключевые сходства.Экспрессия CD34 в разных типах клеток и связанные с этим последствия ранее не представлялись, хотя в избранной литературе содержится обзор экспрессии в отдельных группах клеток. Хотя общая функция CD34 еще предстоит выяснить, анализ и понимание связей между клетками дает представление о роли CD34 в идентификации клеток-предшественников из многих типов тканей. Сводку свойств всех типов клеток CD34 + , обсуждаемых в этом обзоре, можно найти в таблице.

Таблица 1

Сводка различных типов клеток CD34 +

CD34 + Тип клеток Ассоциированные маркеры Потенциал дифференцировки Свойства Ссылка
HLA-DR, CD38, CD117 (c-kit), CD45, CD133 Гематопоэтические клетки, кардиомиоциты, гепатоциты Большое ядро, малая цитоплазма, высокая пролиферативная способность 7, 8
MSC 900-60 St 1, CD73, CD90, CD105, CD146, CD29, CD44, CD271 Адипогенные, остеогенные, хондрогенные, миогенные, ангиогенные МСК CD34 + образуют более высокую долю колоний CFU-f, чем CD34 -.CD34 + MSC обладают высокой пролиферативной способностью. Фибробластные клетки 9– 13
Мышечные сателлитные клетки CD56, Myf5, Desmin, M-кадгерин, CD90, CD106, Flk-1, VEGFR, MyoD, CD146 Миогенные, адипогенные, остеогенные Популяция CD56 + CD34 + может представлять собой более примитивные или плюрипотентные стволовые клетки. In vivo клетки CD34 + расположены вблизи базальной пластинки.Маленькие и круглые 14– 17
Кератоциты CD34, CD133, l-селектин, кератокан, ALDH Фибробластный, миофибробластный, адипогенный, остеогенный, хондрогенный, морфорический эпителиальный эпителий роговицы . Популяция in vitro приобретает фенотип MSC 18– 21
Интерстициальные клетки CD117, виментин, десмин, коннексин-43, PDGFRβ Еще не выяснены полностью Треугольной или веретенообразной формы с большим ядром длинные цитоплазматические отростки.Популяция CD34 + может иметь роль стволовых клеток / предшественников в мочевом пузыре, кишечнике и репродуктивных органах 22– 24
Фиброциты CD45, CD80, CD86, MHC класса I и II Фибробласты , миофибробластический, адипогенный, остеогенный, хондрогенный Веретенообразная форма. CD34 теряется в культуре и при созревании 25– 27
Эпителиальные предшественники CD49f, CD10, CD146, CD71, S100a4, Dkk3, CD133, CD117, ALDH, CD90 Кожные эпителиальные клетки Преимущественно описан в нише HF в коже 28– 33
Эндотелиальные клетки CD146, VE-кадгерин, CD133, CD117, CD14, CD31 Ангиогенез Удлиненные филоподии.Отсутствие плотных стыков. CD34 присутствует на отростках просветной мембраны и экспрессируется на филоподиях во время ангиогенеза in vivo. Спокойный in vivo / низкая активность пролиферации 1, 34, 35

Структура и функция CD34

CD34 представляет собой трансмембранный фосфогликопротеин, впервые идентифицированный в 1984 году на гемопоэтических стволовых и клетках-предшественниках 36 . Он имеет молекулярную массу приблизительно 115 кДа и обладает внеклеточным доменом, который сильно сиалилирован, O-гликозилирован и содержит некоторые сайты N-связанного гликозилирования.Существует единственная трансмембранная спираль и цитоплазматический хвост, который содержит мотивы связывания PDZ (PSD-95-Dlg-ZO-1) -домена 3 , 37 . Наиболее часто описываемым лигандом для CD34 является l-селектин (CD62L), однако адаптерный белок CrkL, известный своей регуляцией адгезии, также связывает CD34 38 , 39 .

Хотя структура CD34 хорошо изучена, о его функции все еще известно относительно мало. Исследования гемопоэтических клеток предполагают роль в цитоадгезии и регуляции дифференцировки и пролиферации клеток 40 , 41 .Лимфоциты проявляют опосредованную l-селектином адгезию к поверхностным белкам CD34 в эндотелии сосудов 38 , 42 , и, кроме того, была выдвинута гипотеза, что CD34 играет роль в транспортировке HSC в ниши в костном мозге (BM ) 41 . Однако, напротив, CD34 также связан с блокированием адгезии, особенно с участием тучных клеток 43 .

CD34 и гемопоэтические клетки

Экспрессия CD34 на гемопоэтических клетках-предшественниках и свойства этих клеток были подробно обсуждены ранее 7 , 44 , 45 и не рассматриваются подробно в данном документе. рассмотрение.В клинической практике экспрессия CD34 оценивается для обеспечения быстрого приживления трансплантатов костного мозга, а также может использоваться в качестве селективного маркера при сортировке клеток для обогащения популяции незрелых гемопоэтических клеток 46 , 47 . Хотя иногда предполагается, что это исключительно маркер стволовых клеток, обнаружение CD34 в BM или образцах крови представляет собой смесь гематопоэтических стволовых клеток и клеток-предшественников, большинство из которых являются клетками-предшественниками 44 . Человеческие HSC дополнительно отделяются от клеток-предшественников CD34 + по низкой экспрессии CD90 и отсутствию экспрессии CD38, лейкоцитарного антигена человека-DR и панели маркеров зрелого гемопоэтического клона (lin -) 7 .CD34 + HSC способны дифференцироваться во все клетки гемопоэтического клона и обладают высокой пролиферативной способностью 7 , 8 . Данные свидетельствуют о том, что HSC CD34 + и предшественники обладают способностью дифференцироваться in vivo в другие клоны, включая клетки респираторного эпителия 48 , гепатоциты 49 и кардиомиоциты 50 . До сих пор свойства HSC CD34 + не были напрямую связаны со свойствами не-HSC CD34 + .

CD34 и стромальные клетки

Мультипотентные МСК

МСК обнаружены в большинстве тканей взрослого человека и представляют собой распространенный и универсальный тип клеток, широко изучаемый для применения в регенеративной медицине 51 . Хотя их потенциал мезенхимальной дифференцировки in vitro хорошо известен, МСК также часто связаны с другими свойствами, включая паракринное заживление ран, способность формировать нишу, иммунную привилегию и иммуномодуляцию 52 , 53 .Номенклатура МСК - спорная тема, существуют разные мнения о том, следует ли идентифицировать клетки как мезенхимальные стволовые клетки или мультипотентные мезенхимальные стромальные клетки, среди многих других названий 54 . В этом обзоре мы используем термин мультипотентные мезенхимальные стромальные клетки, но включаем широкий спектр ссылок, которые в целом относятся к мезенхимальным стволовым клеткам и клеткам-предшественникам. Этот раздел включает исследования МСК из различных источников ткани и обсуждает как свежевыделенные, так и увеличенные в культуре МСК.

В двух недавних обзорах обсуждалась экспрессия CD34 на MSC, оба с акцентом на полученные из жировой ткани MSC 4 , 55 . Хотя Scherberich et al. 55 сосредоточено на структуре и функции CD34 по отношению к MSC, Lin et al. 4 оспаривает мнение о том, что CD34 является негативным маркером MSC. В последнем обзоре обсуждались доказательства, демонстрирующие, что CD34 был важным маркером в ранних исследованиях МСК, выделяя исследование Симмонса и Торок-Сторба, показывающее, что свежевыделенные МСК CD34 + BM образуют большую долю фибробластных колоний (колониеобразующих единиц фибробластов), чем их CD34 - аналоги 9 .Обзор также сделал наблюдение, что CD34 + MSC изначально использовались для скрининга дополнительных иммуногенов MSC, что привело к идентификации Stro-1 56 . Они пришли к выводу, что CD34 следует рассматривать как положительный маркер МСК, с определенной ассоциацией с сосудистой сетью, и предположили, что эти клетки известны как сосудистые стволовые клетки 4 . Хотя Lin et al. освещает несколько ключевых вопросов в определении MSC, обзор лишь кратко затрагивает связь между CD34 и клетками-предшественниками.

В этом же обзоре содержалась критика позиционного документа, опубликованного в 2006 году Международным обществом клеточной терапии (ISCT) 57 , в котором изложены минимальные критерии для того, чтобы клетки считались MSC. Эти критерии, основанные преимущественно на MSC, извлеченных из BM, описывают прилипшую к пластику, увеличенную в культуре популяцию клеток и впоследствии были широко приняты исследовательским сообществом. Один критерий ISCT гласит, что для того, чтобы считаться МСК, популяция клеток должна быть в значительной степени отрицательной по CD34 (≤2% популяции).Это связано с тем, что CD34 является маркером кроветворных клеток, наряду с рядом предыдущих исследований, которые показывают отсутствие CD34 в культивируемых MSC 58 - 60 . В поддержку ISCT, установление четко определенных критериев создало четкий ориентир для описания популяций МСК, позволяя более точные и воспроизводимые сравнения между исследовательскими группами. Популяции МСК демонстрируют высокий уровень гетерогенности, и это разнообразие существует не только в разных тканевых источниках, но также между МСК из одного источника и клональными МСК 60 , 61 .Следовательно, до установления этих критериев многие разнородные типы клеток были описаны как MSC, что привело к неопределенности относительно свойств и характеристик MSC. Тем не менее, при унификации и определении характеристик почти наверняка стромальные предшественники, экспрессирующие маркеры, которые считаются отрицательными или не включены в критерии ISCT, игнорируются исследователями и, что более важно, активно удаляются при соблюдении этих рекомендаций.

Хотя преобладающее мнение утверждает, что MSC являются CD34 , характеризация in vitro преимущественно проводится после культивирования, обычно после нескольких пассажей.Следовательно, это не является репрезентативным для фенотипа in vivo или для первоначально экстрагированного клеточного фенотипа. Было показано, что свежевыделенные стромальные клетки из различных тканей содержат CD34 + клеток 9 - 11 , 63 . Экспрессия CD34 была более широко продемонстрирована на МСК, выделенных из источников, отличных от КМ, таких как жировая ткань, и поэтому более широко принимается исследователями в этих областях 10 , 61 , 64 .CD34 + MSC присутствуют сразу после экстракции, но быстро уменьшаются в количестве после короткого периода культивирования 12 , 13 , 65 . Например, при анализе MSC, полученного из жировой ткани, на P0, Mitchell et al. описали в среднем 59,2% адгезивных клеток, экспрессирующих CD34, которые снизились до 5% при пассаже 2 и впоследствии исчезли 64 . Это изменение экспрессии CD34 при культивировании также отражается в изменениях экспрессии других поверхностных антигенов.Свежеэкстрагированные MSC жировой ткани также демонстрируют низкую экспрессию CD73, CD90 и CD105, которая увеличивается при культивировании; это представляет интерес из-за классификации ISCT их как окончательных маркеров MSC 10 , 64 . Также наблюдается снижение экспрессии других маркеров, связанных с MSC, таких как CD106, CD146 и CD271 12 , 13 , 64 , 66 . Это изменение фенотипа МСК при культивировании, возможно, свидетельствует о процессе дифференциации или реакции на изменения окружающей среды.

Клетки CD34 + представляют долю от общей популяции МСК, и это подмножество клеток обладает различными характеристиками. Экспрессия CD34 связана с высокой эффективностью образования колоний и долговременной способностью к пролиферации 9 , 12 , 63 . CD34 + MSC были связаны с типичными маркерами MSC, наряду с дифференциально экспрессируемыми маркерами, такими как CD271 и Stro-1, и маркерами, обычно связанными с другими типами клеток, включая CD45 и CD133 10 , 12 , 13 , 41 , 42 , 67 , 68 .CD34 + MSC обладают большей склонностью к эндотелиальной трансдифференцировке 14 , 69 . CD34 также обнаруживается на MSC, полученных из эмбриональных стволовых клеток, что также позволяет предположить, что он является маркером ранних человеческих MSC 15 .

Мышечные сателлитные клетки

CD34 обычно используется в качестве маркера мышечных сателлитных клеток как человека, так и мыши, также известных как мышечные стволовые клетки 16 , 70 . Мышечные сателлитные клетки - это маленькие стромальные клетки-предшественники, которые дают начало зрелым клеткам скелетных мышц.In vivo мышечные сателлитные клетки находятся в состоянии покоя, если они не активируются для обеспечения миоядерных волокон миофибриллами в результате увеличения нагрузки с нагрузкой или травм. Активация этих клеток, также рассматриваемая как дифференцировка, соответствует полному подавлению CD34 71 . Было высказано предположение, что CD34 играет фундаментальную роль в регуляции дифференцировки мышечных клеток-предшественников, а также в создании и поддержании популяции сателлитных клеток 71 .

CD34 не экспрессируется на всех мышечных сателлитных клетках, но используется для идентификации наряду с другими маркерами, включая CD56 16 , 17 .На стадии развития самые ранние известные миогенные предшественники не экспрессируют CD34, и во время развития мышц экспрессия CD34 впервые обнаруживается по появлению коммитированных мышечных сателлитных клеток 72 . Это, наряду с одновременной экспрессией миогенных маркеров, таких как Myf5 и M-cadherin, наводит на мысль о сателлитных клетках CD34 + , демонстрирующих предшествующую приверженность миогенной судьбе 71 .

Альтернативные данные предполагают, что клетки CD34 + потенциально могут быть больше, чем миогенные предшественники.Отчетливые MSC-подобные клетки, которые демонстрируют мезенхимальную дифференцировку in vitro, были идентифицированы в местах сателлитов мышц, характеризуя экспрессию CD34 73 . Подобно МСК, экспрессия CD34 на мышечных сателлитных клетках не сохраняется во время культивирования и исчезает по мере дифференциации клеток. Было высказано предположение, что клетки CD34 + , расположенные в интерстициальных пространствах мышц, связаны с эндотелиальными клетками из-за профиля экспрессии CD56 + CD34 + CD144 + 18 .Эти миоэндотелиальные клетки демонстрируют повышенную способность к регенерации мышц по сравнению с клетками, которые экспрессируют только миогенные или эндотелиальные маркеры на мышиной модели in vivo. Они также дифференцируются in vitro по остеогенным и хондрогенным линиям.

Различные наблюдаемые свойства мышечных сателлитных клеток могут быть объяснены наличием отдельных подмножеств клеток CD34 + с различными потенциалами дифференцировки 17 . Маркеры, которые экспрессируются вместе с CD34, влияют на дифференцировку.Например, клетки CD34 + , коэкспрессирующие эндотелиальный маркер CD31, проявляют ангиогенную дифференцировку. Однако популяции клеток CD34 + CD31 - демонстрируют больший потенциал дифференцировки по адипогенному и миогенному клонам 17 .

Кератоциты роговицы

Строма роговицы населена покоящимися клетками, известными как кератоциты, которые демонстрируют дендритную морфологию с обширными клеточными контактами 19 . Подобно мышечным сателлитным клеткам, CD34 является хорошо известным маркером покоящихся кератоцитов in vivo () 74 , 75 .В результате травмы роговицы кератоциты, прилегающие к ране, приобретают более фибробластный фенотип, и экспрессия CD34 быстро исчезает, поскольку клетки становятся «активированными» 20 . После активации они переходят в фибробластный фенотип и связаны с ремоделированием стромальной ткани и образованием рубцов 76 . Активация также происходит in vitro, когда кератоциты культивируются на пластике для тканевых культур, особенно в среде, содержащей сыворотку 65 , 77 .Преобразование кератоцитов в фенотип фибробластов ранее считалось необратимым in vitro, но недавние данные демонстрируют, что тщательное повторение нишеподобной среды и адаптация условий культивирования могут вернуть фибробластные клетки обратно к фенотипу нативных кератоцитов 78 - 80 . Однако еще предстоит исследовать, восстанавливается ли экспрессия CD34.

Экспрессия CD34 кератоцитами. (A): иммунофлуоресценция, показывающая экспрессию CD34 кератоцитами в срезе роговицы человека, окрашенном DAPI.Масштабная линейка = 500 мкм. (B – G): фенотип кератоцитов после культивирования in vitro. Кератоциты человека экстрагировали из стромы роговицы и культивировали в течение 5 дней в среде 199, содержащей 20% фетальной бычьей сыворотки. (B – D): иммуноцитохимия, идентифицирующая отдельные клетки, экспрессирующие CD34, среди клеток, экспрессирующих CD105. (E – G): кератоциты в культуре также экспрессируют маркеры, связанные с MSC, такие как CD90 и CD73. Все изображения контрастировали с помощью Hoechst 33258. Масштабная шкала = 46 мкм.

Функция экспрессии CD34 в кератоцитах еще не выяснена, хотя предполагалось, что CD34 играет роль в регуляции дифференцировки, адгезии и покоя 75 .Хотя было высказано предположение, что кератоциты CD34 + имеют гематопоэтическое происхождение 81 , эти клетки не образуют гематопоэтических колоний при культивировании в полутвердой среде, а клетки CD34 + из этих культур демонстрируют пластичную адгезивную дендритную морфологию 65 . Хотя клетки CD34 + исчезают во время культивирования in vitro, их все еще можно увидеть в ранних культурах при культивировании в среде 199 (B). Эти клетки также экспрессируют типичные стромальные маркеры, такие как CD105, CD90 и CD73 (C – G).In vitro было показано, что кератоциты обладают характеристиками MSC 21 , 82 и после нескольких пассажей, когда CD34 исчез, соответствуют необходимым критериям ISCT 65 . Таким образом, было высказано предположение, что кератоцит является предшественником МСК, обнаруженным в строме роговицы 65 , 83 . Кроме того, недавние исследования показали, что кератоциты CD34 + обладают способностью трансдифференцироваться в эпителиальные клетки роговицы 77 и эндотелиальные клетки 22 , 74 .Это привело к гипотезе о том, что CD34 является маркером тканеспецифического предшественника, который находится в строме, который может давать начало всем клонам роговицы и МСК.

Интерстициальные клетки и фиброциты

CD34 + стромальные клетки были описаны в органах, включая щитовидную железу, дерму, миндалины, матку и семенники 84 . Клетки CD34 + в этих случаях называют дендритными интерстициальными клетками или фиброцитами. Хотя их функция остается неясной, эти клетки проявляют свойства, аналогичные свойствам CD34 + MSC, кератоцитов и мышечных сателлитных клеток, и было высказано предположение, что эти клетки функционируют как клетки-предшественники для определенных тканей.

Интерстициальные клетки CD34 + Cajal (ICC) имеют мезенхимальное происхождение и были впервые идентифицированы в желудочно-кишечном тракте (GI) 85 . Преобладает мнение, что ICC ответственны за модуляцию сокращения гладкой мускулатуры посредством электрических и химических сигналов в качестве кардиостимуляторов. Однако открытие ICC в других тканях, включая поджелудочную железу, миокард, мочевой пузырь, уретру и кровеносные сосуды, поставило под сомнение функциональную роль этих клеток 86 .

Хотя не все ICC экспрессируют CD34, иммунореактивность была показана в подмножестве ICC в желудочно-кишечном тракте мышей и людей 86 . У людей популяции CD34 + были описаны в детрузорной мышце мочевого пузыря, матки и маточных труб человека 23 , 24 . Исследования выявили возможную роль CD34 + ICC как незафиксированных клеток-предшественников 25 . Более того, ICC в мочевом пузыре мышей показала совместную локализацию c-kit и CD34 26 , и авторы предположили функциональную взаимосвязь между CD34 + ICC и тучными клетками.Это подтверждает представление о том, что экспрессия CD34 связана с пластичностью типа клеток ICC и функцией предшественников.

Фиброциты - это мезенхимные клетки-предшественники, которые часто считаются отличными от МСК. Несмотря на это, они представляют собой покоящиеся клетки, которые циркулируют в кровотоке и при травме привлекаются к месту повреждения, где клетки играют роль в воспалении и заживлении ран 27 , 87 . Было показано, что эти клетки продуцируют миофибробластные, фибробластные, адипогенные, хондрогенные и остеогенные фенотипы in vitro 27 , 28 .Фиброциты в настоящее время не распознаются как МСК из-за их маркерного профиля клеточной поверхности, который включает маркеры, связанные с лейкоцитами, включая CD34, CD45, CD80, CD86, и главный комплекс гистосовместимости класса I и II 27 , 28 . Как и в случае с вышеупомянутыми стромальными клетками, экспрессия CD34 исчезает во время культивирования in vitro и in vivo при созревании и дифференцировке 87 . Как и в случае с другими стромальными клетками, было высказано предположение, что и кератоциты, и фиброциты происходят из лейкоцитов благодаря профилю маркера поверхности клетки CD34 + CD45 + 81 .

CD34 и эпителиальные клетки

Экспрессия CD34 эпителиальными предшественниками в коже широко признана 29 , 88 . In vivo каждая единица эпителия содержит волосяной фолликул (HF), а внутри HF есть ниша для стволовых клеток, которая поддерживает эпителиальные слои кожи. Травма эпидермиса приводит к миграции стволовых клеток из этой ниши в место повреждения. В нише есть популяции мультипотентных эпителиальных стволовых клеток, и субпопуляция этих клеток - CD34 + 29 , 89 .Местоположение клеток CD34 + в HF является спорным в зависимости от вида. Большинство исследований было проведено на мышах, и в этих случаях популяция CD34 + находится в выпуклости наружной корневой оболочки (ORS) вместе с другими признанными стволовыми клетками 6 , 29 . Человеческие HF значительно труднее изучать из-за небольшого размера и небольшого количества клеток. Однако признаки показывают, что клетки CD34 + не расположены в выпуклости ORS, а находятся ниже зоны выпуклости, в надбульбарной области 89 - 91 .У людей клетки CD34 + также были идентифицированы в коже между HF, в базальном межфолликулярном эпидермисе, но эти клетки менее изучены 92 . Было высказано предположение, что, поскольку клетки CD34 + не присутствуют в выпуклости ORS взрослого человека, как и большинство других стволовых клеток, они являются потомками стволовых клеток bulge 92 .

HF постоянно проходят стадии активного роста волос (анаген), разрушения (катаген) и покоя (телоген).На этих стадиях изменяется экспрессия маркеров клеточной поверхности и фенотип в HF 6 . Экспрессия CD34 наблюдается в HF человека во время анагена, но не во время катагена и телогена 89 . Авторы предполагают, что это указывает на то, что функция CD34 относится только к пролиферирующим эпителиальным клеткам, а также к адгезии клеток влагалища корня к окружающей строме. Стоит отметить, что хотя человеческие клетки CD34 + не расположены в выступе с другими стволовыми клетками, они расположены в области HF, которая демонстрирует наибольшую клоногенную активность 30 .В человеческих HF клетки, экспрессирующие CD34, не экспрессируют цитокератин 15 (CK15), еще один широко используемый маркер эпителиальных клеток-предшественников 31 , что позволяет предположить наличие более одной популяции клеток-предшественников или иерархии клеток на разных стадиях дифференцировки 89 . CD34 + клетки HF мультипотентны и способны генерировать полностью стратифицированный эпидермис 6 , 32 . Имеются некоторые свидетельства того, что стволовые клетки HF, включая клетки CD34 + , могут быть плюрипотентными, демонстрируя трансдифференцировку в нервные и мезенхимальные клоны 33 , 93 .

Большинство исследований экспрессии CD34 в эпителиальных клетках проводилось на тканях кожи. Однако существует популяция стволовых клеток CD34 + , находящихся в эпителиальных протоках слюнной железы 94 , 95 . Эти клетки сохраняют свою пролиферативную способность при культивировании в трехмерных структурах, известных как салисферы, и демонстрируют дифференцировку в клетки и структуры, напоминающие слюнные железы. Есть также некоторые связи между стромальными клетками CD34 + и эпителиальными клетками.Было показано, что кератоциты CD34 + экспрессируют маркер эпителиальных клеток CK3 96 , а клетки CD34 + из печени плода человека экспрессируют маркеры желчного эпителия CK7, CK8 и CK18 97 .

CD34 и эндотелиальные клетки

CD34 широко считается маркером клеток-предшественников эндотелия сосудов 1 , 98 . Эти клетки, полученные из BM, циркулируют в периферической крови 99 , и их полезность в проангиогенной терапии была тщательно исследована 98 , 99 .Свойства эндотелиальных клеток CD34 + часто связаны с гемопоэтическими клетками, поскольку оба типа клеток можно выделить из периферической крови с использованием CD34 в качестве антигена. Клетки CD34 + , выделенные из периферической крови, были изучены для использования в терапии неоваскуляризации 100 и, кроме того, показали способность дифференцироваться в кардиомиоциты 50 и остеобласты 34 .

Обзор, опубликованный несколько лет назад Matsumoto et al. 35 обсуждали возможное перекрытие между эндотелиальными клетками-предшественниками и остеобластами. Существует циркулирующая популяция CD34 + эндотелиальных / скелетных клеток-предшественников, которые, как считается, происходят из костного мозга, способных дифференцироваться как в остеобласты, так и в эндотелиальные клетки. Продолжаются исследования с использованием циркулирующих клеток CD34 + для лечения несращательных переломов, которые часто страдают от замедленного времени заживления из-за недостаточного кровоснабжения вокруг места повреждения.

Существует подмножество нециркулирующих взрослых эндотелиальных клеток, которые также представляют собой CD34 + , наиболее заметно расположенные в более мелких кровеносных сосудах, в то время как большинство эндотелиальных клеток в более крупных венах и артериях имеют CD34 - 1 . В отличие от типичной булыжной морфологии эндотелиальных клеток, клетки CD34 + более удлинены и не имеют плотных контактов 101 . Экспрессия CD34 преимущественно обнаруживается на просветной мембране клеточных отростков, но также может быть обнаружена на аблюминальной мембране клеток, обнаруженных на концах сосудистых отростков 1 , 102 .Кроме того, эндотелиальные клетки CD34 + находятся в состоянии покоя и, как полагают, участвуют в миграции и адгезии 1 .

Эндотелиальные клетки пупочной вены человека (HUVEC) являются CD34 + in vivo, однако при культивировании in vitro экспрессия теряется после нескольких пассажей, и сохраняется лишь небольшая популяция клеток CD34 + 1 . CD34 + HUVEC имеют отличные морфологические характеристики, включая многочисленные филоподии 101 .Ангиогенные стимулы вызывают миграцию этих клеток, и было высказано предположение, что эта субпопуляция CD34 + гомологична прорастающим верхушечным клеткам, специализированному типу эндотелиальных клеток, присутствующих на переднем крае во время ангиогенеза in vivo 101 . CD34 сильно экспрессируется на филоподиях этих верхушечных клеток в местах активного ангиогенеза, и данные еще раз подчеркивают важную функциональную роль CD34 в активности клеток-предшественников.

Выбор антител к CD34

Тщательный выбор антител, используемых для сортировки и идентификации CD34, имеет первостепенное значение во время исследований.Некоторые моноклональные антитела (mAb) CD34 отбирают эпитопы, чувствительные к расщеплению нейраминидазой (сиалидазой) и гликопротеазой 103 . Следовательно, они зависят от остатков сиаловой кислоты, оставшихся на антигене. По этой причине была разработана классификация эпитопов для mAb к CD34, как показано в таблице. Существует более 30 различных mAb для CD34, нацеленных на разные эпитопы, и клон антитела, использованный в исследованиях, обсуждаемых в этом обзоре, можно увидеть в таблице. Наиболее часто используемые клоны - это MY10, mAb класса Ib, которое частично зависит от присутствия остатков сиаловой кислоты, и QBEnd10, mAb класса II, которое, как было показано, успешно обнаруживает как сиалилированный, так и десиалилированный CD34 103 .Клон QBEnd10 является предпочтительным антителом для иммуногистохимических протоколов, поскольку он устойчив к денатурации и поскольку эпитоп находится на N-конце молекулы CD34, он идеально подходит для таких протоколов отбора, как сортировка клеток с активацией флуоресценции и клетка с магнитной активацией. сортировка. Эпитопы класса III, такие как 8G12, сохраняют высокую специфичность ко всем гликоформам антигена CD34 и поэтому подходят для многих протоколов, включая проточную цитометрию и иммунофлуоресценцию 103 .Следует избегать использования поликлональных антител для сортировки CD34 и иммуноблоттинга из-за возможности неспецифического мечения и высокой вариабельности между партиями антител.

Таблица 2

Выбор антител к CD34: специфичность эпитопа и клоны

.2
Класс эпитопа Клон Тип клеток Проведенные анализы Ссылка
Ia. Чувствительность к нейраминидазе и гликопротеиназе 12.8 Гематопоэтические клетки, МСК, эндотелиальные предшественники Иммуноблоты, иммуноокрашивание, FACS 19, 47
BI.3C5 МСК, кератоциты, эндотелиальные предшественники, Иммуноблоты, FACS 1 75
Фунт. Частично чувствительны к нейраминидазе и гликопротеазе ICh4 МСК, кератоциты, эндотелиальные предшественники Иммуноблоты, иммуноокрашивание, FACS 1, 9, 75, 102
MY10 Гематопоэтические клетки, гематопоэтические клетки, гематопоэтические клетки Иммуноблоттинг, иммуноокрашивание, FACS, вестерн-блоттинг 1, 5, 9, 36, 39, 56, 84
II.Устойчив к нейраминидазе и чувствителен к гликопротеазе QBEnd10 МСК, мышечные сателлитные клетки, кератоциты, интерстициальные клетки, эпителиальные предшественники HF, предшественники эндотелия. Иммуноблоты, иммуноокрашивание, проточная цитометрия 1, 16, 23, 25, 65, 77, 86, 89, 101, 102
III. Устойчивость к нейраминидазе и гликопротеиназе 563 Эпителиальные предшественники HF Иммуноокрашивание 90
581 Клетки-сателлиты мышц, кератоциты Иммуноокрашивание, проточная цитометрия 9042 904 900 28G, 75604 G сателлитные клетки, гемопоэтические клетки, MSC Иммуноокрашивание, проточная цитометрия, FACS 8, 12, 40, 44, 62, 64, 73
TUK3 Эндотелиальные предшественники Иммуноблоты 1
Эндотелиальные предшественники Иммуноблоты 1
Моноклональные (клон не указан) MSC Иммуноокрашивание, проточная цитометрия 10, 58, 59, 63, 69
Эпелитный 904 Проточная цитометрия 91
Тип антитела не указан МСК, мышечные сателлитные клетки, кератоциты, предшественники эпителия HF, предшественники эпителия слюнной железы, предшественники эндотелия Иммуноокрашивание, проточная цитометрия 13–2000 9–4000 , 18 , 21 , 30 , 34 , 60 , 67 , 68 , 70 , 74 , 82 , 83 , 92 94

Практически все методы анализа маркеров клеточной поверхности включают связывание антител с антигеном.Взаимодействия антиген-антитело нековалентны и могут быть обратимыми; поэтому важно тщательно проверить эксперимент. Ключевые представляющие интерес белки могут быть исследованы с использованием нескольких методов, таких как использование альтернативного антитела, методика или анализ транскрипции гена. Чтобы охарактеризовать клеточную популяцию, важно разработать комплексный процесс характеристики, включающий профиль маркеров, как поверхностных, так и внутриклеточных, функциональных анализов и, как в случае стволовых клеток, опрос их потенциалов дифференцировки.

Заключение

CD34 представляет собой маркер клеточной поверхности, который экспрессируется широким спектром клеток, включая гемопоэтические, стромальные, эпителиальные и эндотелиальные клетки. Хотя функция CD34 как поверхностного антигена все еще неизвестна, ее связывают с ингибированием или облегчением адгезии, пролиферации клеток и регуляции дифференцировки 40 , 41 , 55 , 103 . В этом обзоре основное внимание уделялось использованию CD34 для идентификации клеток из различных тканей, обладающих сопоставимыми свойствами (таблица).Заметной связью между всеми типами клеток CD34 + является активность клеток-предшественников и стволовых клеток, и во многих случаях популяция клеток CD34 + демонстрирует более сильную или выраженную способность к дифференцировке. Исследования указывают на корреляцию между пластичностью клеток и экспрессией CD34 с потерей CD34 наряду с другими антигенами клеточной поверхности, что позволяет предположить, что клонирование происходит от более позитивных клеток-предшественников. Многие из этих клеток также демонстрируют состояние покоя in vivo, пока не активируются для дифференцировки.Хотя все типы клеток, обсуждаемые в этом обзоре, экспрессируют CD34, не все они обладают идентичными свойствами. Многие тканеспецифические маркеры коэкспрессируют вместе с CD34, предполагая, что присутствие CD34 может указывать на конкретного предшественника для этой ткани. Доказательства этого, безусловно, очевидны в мышечных сателлитных клетках, кератоцитах и ​​эпителиальных предшественниках. Однако это не обязательно ограничивает способность клеток к дифференцировке in vitro, поскольку многие из клеток CD34 + связаны посредством способности к трансдифференцировке.

Таблица 3

Сопоставимые свойства клеток CD34 +

Сопоставимые свойства клеток CD34 + Описано в:
Потенциальная популяция стволовых клеток / клеток-предшественников HSC мышечные сателлитные клетки, кератоциты, интерстициальные клетки, фиброциты, эпителиальные стволовые клетки HF, предшественники эндотелия сосудов
Покоящиеся in vivo Мышечные сателлитные клетки, кератоциты, интерстициальные клетки, фиброциты
Большая пролиферативная способность емкость in vitro HSC, MSC, эпителиальные стволовые клетки HF
Потеря экспрессии CD34 при «активации» или дифференцировке in vivo или при культивировании in vitro MSC, мышечные сателлитные клетки, кератоциты, фиброциты, эпителиальный ствол HF клетки
Коэкспрессия с тканеспецифическими маркерами Mu сателлитные клетки скле, кератоциты, интерстициальные клетки, эпителиальные стволовые клетки HF, стволовые клетки слюнных желез, предшественники эндотелия сосудов
Потенциал трансдифференцировки HSC, MSC, сателлитные клетки мышц, кератоциты, эпителиальные стволовые клетки HF, предшественники эндотелия сосудов

Хотя CD34 может быть одним из маркеров, который полезен для идентификации популяций предшественников, один единственный маркер не подходит для характеристики типа клеток.Экспрессия CD34 всеми типами клеток, обсуждаемыми в обзоре, не может быть исключительной. Из-за отсутствия согласованных исследований мы пока не можем идентифицировать другой маркер, который появляется на всех клетках, но такие маркеры, как CD90, CD117 (c-kit), CD146 и CD133, были указаны более чем для одного типа клеток. Чтобы полностью охарактеризовать популяцию стволовых клеток, наиболее вероятно, что потребуется определенный профиль маркера, наряду с клональными анализами, анализами дифференцировки и функциональным профилированием.

Культивирование и размножение прикрепленных клеток CD34 + in vitro является сложной задачей.Вероятно, это связано с ассоциацией CD34 с покоем и адгезией, а также с потерей экспрессии CD34 при дифференцировке. Культивирование на пластике для тканевых культур и в среде, содержащей сыворотку, создает среду, отличную от среды in vivo, заставляя клетки пролиферировать и дифференцироваться с последующей потерей CD34. Если клетки CD34 + должны быть исследованы in vitro, необходимы специальные условия культивирования и оптимизация, чтобы воспроизвести среду, более похожую на нишу in vivo.

При составлении этого обзора мы хотели бы предположить, что CD34 считается поверхностным антигеном, подходящим для отбора субпопуляций клеток-предшественников из более крупных клеточных популяций, включая мезенхимальные клетки, и не связан только с гемопоэтическими и эндотелиальными клетками. Признание CD34 в качестве маркера предшественника позволит провести дальнейшие исследования этого особого подмножества клеток, которые потенциально обладают ярко выраженной способностью к дифференцировке. Если методы культивирования и размножения этих клеток могут быть оптимизированы, клетки CD34 + из многих типов тканей могут представлять собой источник клеток-предшественников, которые могут быть использованы клинически в стратегиях регенеративной медицины.

Благодарности

Эта работа была поддержана грантами Королевского колледжа хирургов Эдинбурга и Fight for Sight. S.E.D. финансируется Центром подготовки докторантов по регенеративной медицине EPSRC. Авторы хотели бы поблагодарить г-на Оуэна Макинтоша за обсуждения и помощь с корректурой.

Вклад авторов

L.E.S. и M.J.B .: концепция и дизайн, сбор и сборка данных, анализ и интерпретация данных, а также написание рукописей; С.E.D .: анализ и интерпретация данных и написание рукописей; H.S.D. и A.H .: финансовая поддержка, окончательное утверждение рукописи.

Раскрытие информации о потенциальном конфликте интересов

Авторы не указывают на потенциальный конфликт интересов.

Ссылки

1. Fina L, Molgaard HV, Robertson D, et al. Экспрессия гена CD34 в эндотелиальных клетках сосудов. Кровь. 1990; 75: 2417–2426. [PubMed] [Google Scholar] 2. Браун Дж., Гривз М.Ф., Мольгаард Х.В. Ген, кодирующий антиген стволовых клеток, CD34, консервативен у мышей и экспрессируется в линиях гемопоэтических клеток-предшественников, головном мозге и эмбриональных фибробластах.Int Immunol. 1991; 3: 175–184. [PubMed] [Google Scholar] 3. Нильсен Дж. С., МакНагни К. М.. Новые функции семейства CD34. J Cell Sci. 2008; 121: 3683–3692. [PubMed] [Google Scholar] 5. Накаяма Х., Энзан Х., Миядзаки Э. и др. Дифференциальная экспрессия CD34 в нормальной колоректальной ткани, перитуморальной воспалительной ткани и строме опухоли. J Clin Pathol. 2000. 53: 626–629. [Бесплатная статья PMC] [PubMed] [Google Scholar] 6. Blanpain C, Lowry WE, Geoghegan A и др. Самообновление, мультипотентность и наличие двух популяций клеток в нише эпителиальных стволовых клеток.Клетка. 2004. 118: 635–648. [PubMed] [Google Scholar] 7. Хасс Р. Выделение первичных и иммортализованных CD34-гематопоэтических и мезенхимальных стволовых клеток из различных источников. Стволовые клетки. 2000; 18: 1–9. [PubMed] [Google Scholar] 8. Servida F, Soligo D, Caneva L и др. Функциональная и морфологическая характеристика иммуномагнитно отобранных гематопоэтических клеток-предшественников CD34 + . Стволовые клетки. 1996. 14: 430–438. [PubMed] [Google Scholar] 9. Симмонс П.Дж., Торок-Сторб Б. Экспрессия CD34 предшественниками стромы в нормальном костном мозге взрослого человека.Кровь. 1991; 78: 2848–2853. [PubMed] [Google Scholar] 10. Йошимура К., Шигеура Т., Мацумото Д. и др. Характеристика свежевыделенных и культивированных клеток, полученных из жировой и жидкой частей липосакционных аспиратов. J. Cell Physiol. 2006; 208: 64–76. [PubMed] [Google Scholar] 11. Ферраро Г.А., Де Франческо Ф., Николетти Дж. И др. Человеческие жировые CD34 (+) CD90 (+) стволовые клетки и конструкции коллагенового каркаса, привитые in vivo, образуют рыхлые соединительные и жировые ткани. J Cell Biochem. 2013; 114: 1039–1049.[PubMed] [Google Scholar] 12. Куиричи Н., Солиго Д., Боссоласко П. и др. Выделение мезенхимальных стволовых клеток костного мозга антителами против рецепторов фактора роста нервов. Exp Hematol. 2002; 30: 783–791. [PubMed] [Google Scholar] 13. Куци С., Куци З., Крейенберг Х. и др. Антиген CD271 определяет подмножество мультипотентных стромальных клеток с иммуносупрессивными и лимфогематопоэтическими свойствами, способствующими приживлению трансплантата. Haematologica. 2010; 95: 651–659. [Бесплатная статья PMC] [PubMed] [Google Scholar] 14. Де Франческо Ф., Тирино В., Дезидерио В. и др.Человеческие CD34 / CD90 ASC способны расти в виде сферических кластеров, продуцируя высокие уровни VEGF и формируя капилляры. PLoS One. 2009; 4: e6537. [Бесплатная статья PMC] [PubMed] [Google Scholar] 15. Копер Р.А., Пенчев В.Р., Ислам М.С. и др. Клетки CD34 + , полученные из эмбриональных стволовых клеток человека, функционируют как клетки-предшественники МСК. Кость. 2010; 47: 718–728. [Бесплатная статья PMC] [PubMed] [Google Scholar] 16. Синанан А.С., Хант Н.П., Льюис М.П. Клетки, полученные из черепно-лицевых мышц взрослого человека: клетки, экспрессирующие молекулу адгезии нервных клеток (NCAM; CD56), по-видимому, содержат мультипотенциальные стволовые клетки.Biotechnol Appl Biochem. 2004. 40: 25–34. [PubMed] [Google Scholar] 17. Дюпа Т., Руо Т., Ружер К. и др. Мышцы плода содержат различные субпопуляции клеток CD34 + , которые четко дифференцируются на адипогенные, ангиогенные и миогенные клоны. Stem Cell Res. 2011; 7: 230–243. [PubMed] [Google Scholar] 18. Чжэн Б., Цао Б., Крисан М. и др. Перспективная идентификация миогенных эндотелиальных клеток в скелетных мышцах человека. Nat Biotechnol. 2007. 25: 1025–1034. [PubMed] [Google Scholar] 19. Пул, Калифорния, Брукс, Нью-Хэмпшир, Клевер GM.Сети кератоцитов визуализируются в живой роговице с помощью витальных красителей. J Cell Sci. 1993. 106 (Pt 2): 685–691. [PubMed] [Google Scholar] 20. West-Mays JA, Dwivedi DJ. Кератоцит: стромальные клетки роговицы с различными фенотипами восстановления. Int J Biochem Cell Biol. 2006; 38: 1625–1631. [Бесплатная статья PMC] [PubMed] [Google Scholar] 22. Hatou S, Yoshida S, Higa K и др. Функциональный эндотелий роговицы, полученный из стволовых клеток стромы роговицы, происходящих из нервного гребня, с помощью ретиноевой кислоты и передачи сигналов Wnt / бета-катенин.Stem Cells Dev. 2013; 22: 828–839. [PubMed] [Google Scholar] 23. Расмуссен Х., Хансен А., Смедтс Ф. и др. CD34-положительные интерстициальные клетки детрузора человека. APMIS. 2007. 115: 1260–1266. [PubMed] [Google Scholar] 24. Popescu LM, Ciontea SM, Cretoiu D. Интерстициальные клетки Кахаля в матке и фаллопиевых трубах человека. Ann N Y Acad Sci. 2007; 1101: 139–165. [PubMed] [Google Scholar] 25. Попеску Л.М., Чионтеа С.М., Кретою Д. и др. Новый тип интерстициальной клетки (типа Кахаля) в фаллопиевой трубе человека. J Cell Mol Med.2005; 9: 479–523. [Бесплатная статья PMC] [PubMed] [Google Scholar] 26. Ю В., Зейдель М.Л., Хилл В.Г. Профиль клеточной экспрессии интерстициальных клеток кахаля в мочевом пузыре - клетки, часто ошибочно идентифицируемой как миоцит или миофибробласт. PLoS One. 2012; 7: e48897. [Бесплатная статья PMC] [PubMed] [Google Scholar] 27. Кили Е.К., Мехрад Б., Стритер Р.М. Роль циркулирующих мезенхимальных клеток-предшественников (фиброцитов) в патогенезе фиброзных нарушений. Thromb Haemost. 2009. 101: 613–618. [Бесплатная статья PMC] [PubMed] [Google Scholar] 28.Чой YH, Burdick MD, Strieter RM. Циркулирующие фиброциты человека обладают способностью дифференцировать остеобласты и хондроциты. Int J Biochem Cell Biol. 2010. 42: 662–671. [Бесплатная статья PMC] [PubMed] [Google Scholar] 30. Рочат А., Кобаяши К., Баррандон Ю. Расположение стволовых клеток волосяных фолликулов человека с помощью клонального анализа. Клетка. 1994; 76: 1063–1073. [PubMed] [Google Scholar] 31. Васим А., Доган Б., Тидман Н. и др. Экспрессия кератина 15 в многослойном эпителии: подавление активированных кератиноцитов.J Invest Dermatol. 1999; 112: 362–369. [PubMed] [Google Scholar] 32. Гутьеррес-Ривера А., Павон-Родригес А., Хименес-Акоста Ф. и др. Функциональная характеристика высокоприлипающих кератиноцитов CD34 + , выделенных из кожи человека. Exp Dermatol. 2010. 19: 685–688. [PubMed] [Google Scholar] 33. Зибер-Блюм М., Грим М., Ху Ю.Ф. и др. Плюрипотентные стволовые клетки нервного гребня в волосяном фолликуле взрослого человека. Dev Dyn. 2004. 231: 258–269. [PubMed] [Google Scholar] 34. Tondreau T, Meuleman N, Delforge A и др. Мезенхимальные стволовые клетки, полученные из CD133-положительных клеток мобилизованной периферической крови и пуповинной крови: пролиферация, экспрессия Oct4 и пластичность.Стволовые клетки. 2005. 23: 1105–1112. [PubMed] [Google Scholar] 35. Мацумото Т., Курода Р., Мифуне Ю. и др. Циркулирующие эндотелиальные / скелетные клетки-предшественники для регенерации и заживления костей. Кость. 2008. 43: 434–439. [PubMed] [Google Scholar] 36. Civin CI, Strauss LC, Brovall C и др. Антигенный анализ кроветворения. III. Гемопоэтический антиген клеточной поверхности-предшественника, определяемый моноклональным антителом, индуцированным против клеток KG-1a. J Immunol. 1984. 133: 157–165. [PubMed] [Google Scholar] 37. Краузе Д.С., Ито Т., Факлер М.Дж. и др.Характеристика мышиного CD34, маркера гематопоэтических клеток-предшественников и стволовых клеток. Кровь. 1994; 84: 691–701. [PubMed] [Google Scholar] 38. Баумхетер С., Зингер М.С., Хензель В. и др. Связывание L-селектина с сосудистым сиаломуцином CD34. Наука. 1993; 262: 436–438. [PubMed] [Google Scholar] 39. Felschow DM, McVeigh ML, Hoehn GT, et al. Адаптерный белок CrkL ассоциируется с CD34. Кровь. 2001; 97: 3768–3775. [PubMed] [Google Scholar] 40. Хили Л., Мэй Дж., Гейл К. и др. Антиген стволовых клеток CD34 действует как регулятор адгезии гемопоэтических клеток.Proc Natl Acad Sci USA. 1995; 92: 12240–12244. [Бесплатная статья PMC] [PubMed] [Google Scholar] 41. Нильсен Дж. С., МакНагни К. М.. CD34 является ключевым регулятором доставки гемопоэтических стволовых клеток в костный мозг и транспорта предшественников тучных клеток на периферии. Микроциркуляция. 2009. 16: 487–496. [PubMed] [Google Scholar] 42. Мясник EC, Picker LJ. Направление лимфоцитов и гомеостаз. Наука. 1996. 272: 60–66. [PubMed] [Google Scholar] 43. Дрю Э., Мерзабан Дж. С., Сео В. и др. CD34 и CD43 ингибируют адгезию тучных клеток и необходимы для оптимального восстановления тучных клеток.Иммунитет. 2005. 22: 43–57. [PubMed] [Google Scholar] 44. Majeti R, Park CY, Weissman IL. Идентификация иерархии мультипотентных гематопоэтических предшественников в пуповинной крови человека. Стволовая клетка. 2007; 1: 635–645. [Бесплатная статья PMC] [PubMed] [Google Scholar] 46. Берарди А.С., Ван А., Левин Дж. Д. и др. Функциональная изоляция и характеристика гемопоэтических стволовых клеток человека. Наука. 1995; 267: 104–108. [PubMed] [Google Scholar] 47. Беренсон Р.Дж., Бенсингер В.И., Хилл Р.С. и др. Приживление после инфузии клеток костного мозга CD34 + у пациентов с раком груди или нейробластомой.Кровь. 1991; 77: 1717–1722. [PubMed] [Google Scholar] 48. Мао К., Чу С., Ганта С. и др. Размноженные ex vivo гематопоэтические клетки-предшественники, полученные из пуповинной крови человека, вызывают рост легких и альвеоляризацию в поврежденных легких новорожденных. Respir Res. 2013; 14: 37. [Бесплатная статья PMC] [PubMed] [Google Scholar] 49. Джанг Й.Й., Коллекционер М.И., Бейлин С.Б. и др. Гемопоэтические стволовые клетки без слияния превращаются в клетки печени в течение нескольких дней. Nat Cell Biol. 2004; 6: 532–539. [PubMed] [Google Scholar] 50. Чжан С., Ван Д., Эстров З. и др.Как слияние клеток, так и трансдифференцировка объясняют трансформацию CD34-положительных клеток периферической крови человека в кардиомиоциты in vivo. Тираж. 2004; 110: 3803–3807. [PubMed] [Google Scholar] 51. da Silva Meirelles L, Chagastelles PC, Nardi NB. Мезенхимальные стволовые клетки находятся практически во всех постнатальных органах и тканях. J Cell Sci. 2006; 119: 2204–2213. [PubMed] [Google Scholar] 52. Финни Д.Г., Прокоп DJ. Краткий обзор: Мезенхимальные стволовые / мультипотентные стромальные клетки: состояние трансдифференцировки и способы восстановления тканей - современные взгляды.Стволовые клетки. 2007; 25: 2896–2902. [PubMed] [Google Scholar] 53. Чемберлен Дж., Фокс Дж., Эштон Б. и др. Краткий обзор: Мезенхимальные стволовые клетки: их фенотип, способность к дифференцировке, иммунологические особенности и потенциал для хоминга. Стволовые клетки. 2007. 25: 2739–2749. [PubMed] [Google Scholar] 54. Хорвиц Э.М., Ле Блан К., Доминичи М. и др. Уточнение номенклатуры для MSC: заявление о позиции Международного общества клеточной терапии. Цитотерапия. 2005; 7: 393–395. [PubMed] [Google Scholar] 55.Scherberich A, Di Maggio ND, McNagny KM. Знакомый незнакомец: экспрессия CD34 и предполагаемые функции в клетках SVF жировой ткани. Стволовые клетки мира J. 2013; 5: 1–8. [Бесплатная статья PMC] [PubMed] [Google Scholar] 56. Симмонс П.Дж., Торок-Сторб Б. Идентификация предшественников стромальных клеток в костном мозге человека с помощью нового моноклонального антитела STRO-1. Кровь. 1991; 78: 55–62. [PubMed] [Google Scholar] 57. Доминичи М., Ле Блан К., Мюллер И. и др. Минимальные критерии для определения мультипотентных мезенхимальных стромальных клеток.Заявление о позиции Международного общества клеточной терапии. Цитотерапия. 2006; 8: 315–317. [PubMed] [Google Scholar] 58. Питтенгер М.Ф., Маккей А.М., Бек С.К. и др. Многолинейный потенциал мезенхимальных стволовых клеток взрослого человека. Наука. 1999; 284: 143–147. [PubMed] [Google Scholar] 60. Wagner W, Wein F, Seckinger A, et al. Сравнительная характеристика мезенхимальных стволовых клеток из костного мозга, жировой ткани и пуповинной крови человека. Exp Hematol. 2005; 33: 1402–1416. [PubMed] [Google Scholar] 61.Финни Д.Г., Сенсебе Л. Мезенхимальные стромальные клетки: заблуждения и развивающиеся концепции. Цитотерапия. 2013; 15: 140–145. [PubMed] [Google Scholar] 62. Гронтос С., Франклин Д.М., Ледди Н.А. и др. Характеристика поверхностного белка стромальных клеток жировой ткани человека. J. Cell Physiol. 2001; 189: 54–63. [PubMed] [Google Scholar] 63. Валлер Е.К., Олвеус Дж., Лунд-Йохансен Ф. и др. Гипотеза «общих стволовых клеток» пересмотрена: костный мозг плода человека содержит отдельные популяции гематопоэтических и стромальных предшественников.Кровь. 1995; 85: 2422–2435. [PubMed] [Google Scholar] 64. Митчелл Дж. Б., Макинтош К., Звоник С. и др. Иммунофенотип человеческих жировых клеток: временные изменения маркеров, связанных со стромой и стволовыми клетками. Стволовые клетки. 2006. 24: 376–385. [PubMed] [Google Scholar] 65. Бранч М.Дж., Хашмани К., Диллон П. и др. Мезенхимальные стволовые клетки в лимбальной строме роговицы человека. Инвестируйте Ophthalmol Vis Sci. 2012; 53: 5109–5116. [PubMed] [Google Scholar] 66. Халфон С., Абрамов Н., Гринблат Б. и др. Маркеры, отличающие мезенхимальные стволовые клетки от фибробластов, подавляются при пассировании.Stem Cells Dev. 2011; 20: 53–66. [PubMed] [Google Scholar] 67. Ферраро Г.А., Де Франческо Ф., Николетти Дж. И др. Человеческие жировые клетки CD34 + CD90 + стволовые клетки и конструкции коллагенового каркаса, привитые in vivo, образуют рыхлые соединительные и жировые ткани. J Cell Biochem. 2013; 114: 1039–1049. [PubMed] [Google Scholar] 68. Кайзер С., Хакансон Б., Фолло М. и др. Клетки ВМ, дающие начало МСК в культуре, имеют гетерогенный фенотип CD34 и CD45. Цитотерапия. 2007; 9: 439–450. [PubMed] [Google Scholar] 69.Миранвиль А., Хеешен С., Сенгенес С. и др. Улучшение постнатальной неоваскуляризации стволовыми клетками жировой ткани человека. Тираж. 2004. 110: 349–355. [PubMed] [Google Scholar] 70. Ли Дж.Й., Ку-Петерсен З., Цао Б. и др. Клональная изоляция мышечных клеток, способных улучшить регенерацию мышц и заживление костей. J Cell Biol. 2000; 150: 1085–1100. [Бесплатная статья PMC] [PubMed] [Google Scholar] 71. Beauchamp JR, ​​Heslop L, Yu DS, et al. Экспрессия CD34 и Myf5 определяет большинство покоящихся сателлитных клеток скелетных мышц взрослых.J Cell Biol. 2000; 151: 1221–1234. [Бесплатная статья PMC] [PubMed] [Google Scholar] 72. Cossu G, Molinaro M, Pacifici M. Дифференциальный ответ сателлитных клеток и эмбриональных миобластов на промотор опухоли. Dev Biol. 1983; 98: 520–524. [PubMed] [Google Scholar] 73. Lecourt S, Marolleau JP, Fromigue O и др. Характеристика различных популяций мезенхимальных клеток скелетных мышц человека in situ и in vitro. Exp Cell Res. 2010; 316: 2513–2526. [PubMed] [Google Scholar] 74. Перрелла Дж., Брусини П., Спелат Р. и др.Экспрессия маркеров гемопоэтических стволовых клеток, CD133 и CD34 на кератоцитах роговицы человека. Br J Ophthalmol. 2007. 91: 94–99. [Бесплатная статья PMC] [PubMed] [Google Scholar] 75. Джозеф А., Хоссейн П., Джам С. и др. Экспрессия CD34 и l-селектина на кератоцитах роговицы человека. Инвестируйте Ophthalmol Vis Sci. 2003; 44: 4689–4692. [PubMed] [Google Scholar] 76. Фундербург Дж. Л., Манн М. М., Фундербург М. Л.. Фенотип кератоцитов опосредует структуру протеогликана: роль фибробластов в фиброзе роговицы. J Biol Chem.2003; 278: 45629–45637. [Бесплатная статья PMC] [PubMed] [Google Scholar] 77. Хашмани К., Бранч М.Дж., Сидней Л.Е. и др. Характеристика стромальных стволовых клеток роговицы с потенциалом эпителиальной трансдифференцировки. Stem Cell Res Ther. 2013; 4: 75. [Бесплатная статья PMC] [PubMed] [Google Scholar] 78. Ву Дж, Ду Й, Манн М.М. и др. Биоинженерия организовала многослойную стромальную ткань роговицы человека путем добавления факторов роста на высоко выровненные синтетические субстраты. Tissue Eng Часть A. 2013; 19: 2063–2075.[Бесплатная статья PMC] [PubMed] [Google Scholar] 79. Уилсон С.Л., Ян Й., Эль-Хадж А.Дж. Пластичность стромальных клеток роговицы: регуляция клеточного фенотипа in vitro через межклеточные взаимодействия в трехмерной модели. Tissue Eng Часть A. 2014; 20: 225–238. [Бесплатная статья PMC] [PubMed] [Google Scholar] 80. Du Y, Sundarraj N, Funderburgh ML, et al. Секреция и организация роговичной ткани in vitro стволовыми клетками стромы роговицы человека. Инвестируйте Ophthalmol Vis Sci. 2007. 48: 5038–5045. [Бесплатная статья PMC] [PubMed] [Google Scholar] 81.Соснова М, Брэдл М, Форрестер СП. CD34 + стромальные клетки роговицы происходят из костного мозга и экспрессируют маркеры гемопоэтических стволовых клеток. Стволовые клетки. 2005. 23: 507–515. [PubMed] [Google Scholar] 82. Чунг П.Ф., Мок П.Л., Чонг С.К. и др. Характеристики мезенхимальных стромальных клеток кератоцитов роговицы. Цитотерапия. 2007. 9: 252–258. [PubMed] [Google Scholar] 83. Ли Г.Г., Чжу Ю.Т., Се Х.Т. и др. Мезенхимальные стволовые клетки, полученные из клеток лимбальных ниш человека. Инвестируйте Ophthalmol Vis Sci. 2012; 53: 5686–5697.[Бесплатная статья PMC] [PubMed] [Google Scholar] 84. Курода Н., Накаяма Х., Миядзаки Э. и др. Распределение и роль CD34-положительных стромальных клеток и миофибробластов в нормальной строме яичка человека. Histol Histopathol. 2004; 19: 743–751. [PubMed] [Google Scholar] 85. Хункера С., Мартинес-Чириано С., Кастиелла Т. и др. Иммуногистохимические и ультраструктурные характеристики интерстициальных клеток Кахаля двенадцатиперстной кишки кролика. Наличие единственной реснички. J Cell Mol Med. 2007. 11: 776–787. [Бесплатная статья PMC] [PubMed] [Google Scholar] 86.Vanderwinden JM, Rumessen JJ, De Laet MH, et al. Иммунореактивность CD34 и интерстициальные клетки Кахаля в желудочно-кишечном тракте человека и мыши. Cell Tissue Res. 2000. 302: 145–153. [PubMed] [Google Scholar] 87. Букала Р. Циркулирующие фиброциты: клеточная основа для NSF. J Am Coll Radiol. 2008; 5: 36–39. [PubMed] [Google Scholar] 89. Поблет Э., Хименес Ф., Годинес Дж. М. и др. Иммуногистохимическая экспрессия CD34 в волосяных фолликулах человека: сравнительное исследование с маркером выпуклости CK15. Clin Exp Dermatol.2006. 31: 807–812. [PubMed] [Google Scholar] 90. Охьяма М., Терунума А., Ток К.Л. и др. Характеристика и выделение обогащенных стволовыми клетками клеток выпуклости волосяного фолликула человека. J Clin Invest. 2006; 116: 249–260. [Бесплатная статья PMC] [PubMed] [Google Scholar] 92. Цзян С., Чжао Л., Пурандаре Б. и др. Дифференциальная экспрессия маркеров стволовых клеток в выпуклости фолликулов человека и межфолликулярных эпидермальных компартментах. Histochem Cell Biol. 2010. 133: 455–465. [PubMed] [Google Scholar] 93. Амо Й., Ли Л., Кацуока К. и др.Мультипотентные нестин-положительные и кератин-отрицательные стволовые клетки выпуклости волосяных фолликулов могут образовывать нейроны. Proc Natl Acad Sci USA. 2005. 102: 5530–5534. [Бесплатная статья PMC] [PubMed] [Google Scholar] 94. Бань А., Сяо Н., Цао Х. и др. Новый активатор альдегиддегидрогеназы-3 приводит к обогащению стволовыми клетками слюны взрослых in vivo. Clin Cancer Res. 2011. 17: 7265–7272. [Бесплатная статья PMC] [PubMed] [Google Scholar] 95. Прингл С., Ван Ос Р., Коппс Р.П. Краткий обзор: Стволовые клетки слюнных желез взрослых и потенциальная терапия ксеростомии.Стволовые клетки. 2012; 31: 613–619. [PubMed] [Google Scholar] 96. Перрелла Дж., Скотт К.А., Спелат Р. и др. Культивированные кератоциты гимана из лимба и роговицы экспрессируют эпителиальный цитокератин 3: возможен мезенхимально-эпителиальный переход. Int J Ophthalmic Pathol. 2012; 1: 1–7. [Google Scholar] 97. Lemmer ER, Shepard EG, Blakolmer K, et al. Выделение из печени плода человека клеток, коэкспрессирующих гематопоэтические стволовые клетки CD34 и маркеры панцитокератина CAM 5.2. J Hepatol. 1998. 29: 450–454. [PubMed] [Google Scholar] 98.Христов М., Вебер С. Эндотелиальные клетки-предшественники в восстановлении и ремоделировании сосудов. Pharmacol Res. 2008. 58: 148–151. [PubMed] [Google Scholar] 99. Бренес Р.А., Медведь М., Ядловец С. и др. Клеточные вмешательства для терапевтического ангиогенеза: обзор потенциальных источников клеток. Сосудистый. 2012. 20: 360–368. [Бесплатная статья PMC] [PubMed] [Google Scholar] 100. Mackie AR, Losordo DW. CD34-положительные стволовые клетки: при лечении сердечно-сосудистых заболеваний у человека. Tex Heart Inst J. 2011; 38: 474–485. [Бесплатная статья PMC] [PubMed] [Google Scholar] 101.Siemerink MJ, Klaassen I., Vogels IM, et al. CD34 маркирует концевые ангиогенные клетки в культурах эндотелиальных клеток сосудов человека. Ангиогенез. 2012; 15: 151–163. [Бесплатная статья PMC] [PubMed] [Google Scholar] 102. Шлингеманн Р.О., Ритвельд Ф.Дж., де Ваал Р.М. и др. Лейкоцитарный антиген CD34 экспрессируется субпопуляцией культивируемых эндотелиальных клеток и эндотелиальными аблюминальными микропроцессами в строме опухоли. Lab Invest. 1990; 62: 690–696. [PubMed] [Google Scholar] 103. Ланза Ф, Хили Л, Сазерленд ДР. Структурные и функциональные особенности антигена CD34: обновление.Средства для гомеостаза J Biol Regul. 2001; 15: 1–13. [PubMed] [Google Scholar]

CD34 + или CD34−: что более примитивно?

  • 1

    Civin CI, Strauss LC, Brovall C, Fackler MJ, Schwartz JF, Shaper JH. Антигенный анализ кроветворения III. Гемопоэтический антиген клеточной поверхности-предшественника, определенный с помощью моноклонального антитела против клеток KG-1a J Immunol 1985 133 : 157–164

    Google ученый

  • 2

    Andrews RE, Singer JW, Bernstein ID.Предшественники колониеобразующих клеток у человека можно отличить от колониеобразующих клеток по экспрессии антигена CD33 и CD34 и светорассеянию J Exp Med 1989 169 : 1721–1731

    CAS Google ученый

  • 3

    Krause DS, Fackler MJ, Civin CI, May WS. CD34: структура, биология и клиническое применение Кровь 1996 87 : 1–13

    CAS Google ученый

  • 4

    Sutherland HJ, Eaves CJ, Eaves AC, Dragowska W, Lansdorp PM.Характеристика и частичная очистка клеток костного мозга человека, способных инициировать длительный гематопоэз in vitro Кровь 1989 74 : 1563–1570

    CAS Google ученый

  • 5

    Бхатия М., Ван Дж. К., Капп У., Боннет Д., Дик Дж. Очистка примитивных гемопоэтических клеток человека, способных репопуляцию мышей с иммунодефицитом Proc Natl Acad Sci USA 1997 94 : 5320–5325

    CAS Google ученый

  • 6

    Орлик Д., Бодин Д.Что определяет плюрипотентные гемопоэтические стволовые клетки (PHSC): встаньте, пожалуйста, настоящий PHSC! Кровь 1994 84 : 3991–3994

    CAS Google ученый

  • 7

    Spangrude GJ, Heimfeld S, Weissman IL. Очистка и характеристика гемопоэтических стволовых клеток мыши Science 1988 241 : 58–62

    CAS Google ученый

  • 8

    Uchida N, Weissman IL.Поиск гемопоэтических стволовых клеток: доказательства того, что клетки Thy-1.1 lo Lin - Sca-1 + являются единственными стволовыми клетками в костном мозге C57BL / Ka-Thy-1.1 J Exp Med 1992 175 : 175–184

    CAS Google ученый

  • 9

    Okada S, Nakachi H, Nagayoshi K, Nagayishi K, Nishikawa S, Miura Y, Suda T. In vivo и in vitro Функция стволовых клеток c-kit- и Sca-1-положительных гемопоэтических клеток мыши Кровь 1992 80 : 3044–3050

    CAS PubMed Google ученый

  • 10

    Ikuta K, Weissman IL.Доказательства того, что гемопоэтические стволовые клетки экспрессируют мышиный c-kit, но не зависят от стального фактора для их поколения Proc Natl Acad Sci USA 1992 89 : 1502–1506

    CAS PubMed Google ученый

  • 11

    Szilvassy SJ, Lansdorp PM, Humphries RK, Eaves AC, Eaves CJ. Выделение в одну стадию высокообогащенной популяции гемопоэтических стволовых клеток мышей с конкурентоспособной способностью к долгосрочному репопуляции Кровь 1989 74 : 930–939

    CAS PubMed Google ученый

  • 12

    Морел Ф, Сзилвассы С.Дж., Трэвис М., Чен Б., Гали А.Примитивные гемопоэтические клетки в костном мозге мышей экспрессируют антиген CD34 Кровь 1996 88 : 3774–3784

    CAS PubMed Google ученый

  • 13

    Краузе Д.С., Ито Т., Факлер М.Дж., Смит О.М., Коллектор М.И., Шаркис С.Дж., Мэй В.С. Характеристика мышиного CD34, маркера гематопоэтических клеток-предшественников и стволовых клеток Кровь 1994 84 : 691–901

    CAS Google ученый

  • 14

    Галлахер Л., Мердок Б., Ву Д.М., Карану Ф.Н., Кини М., Бхатия М.Выделение и характеристика человеческих CD34 (-) Lin (-) и CD34 (+) Lin (-) гемопоэтических стволовых клеток с использованием маркеров клеточной поверхности AC133 и CD7 Кровь 2000 95 : 2813–2820

    CAS PubMed PubMed Central Google ученый

  • 15

    Civin CI, Almeida-Porada G, Lee MJ, Olweus J, Terstappen LWMM. Устойчивое, ретрансплантируемое, многолинейное приживление высокоочищенных стволовых клеток костного мозга взрослого человека in vivo Кровь 1996 88 : 4102–4109

    CAS Google ученый

  • 16

    Link H, Арсеньев L, BΩhre O, Kadar JG, Diedrich H, Poliwoda H.Трансплантация аллогенных CD34 + клеток крови Кровь 1996 87 : 4903–4909

    CAS PubMed Google ученый

  • 17

    Урбано-Испизуа А, Розман С., Мартинаэс С., Марин П., Брионес Дж., Ровира М., Фелиз П., Вигурия МС, Мерино А., Сьерра Дж, Маццара Р., Кааэрас Е., Монтсеррат Е. Быстрое приживление трансплантата без значительной реакции трансплантат против хозяина после аллогенной трансплантации CD34 + выбранных клеток из периферической крови Кровь 1997 89 : 3967–3973

    CAS PubMed Google ученый

  • 18

    Энгельгардт М., Бертц Х., Афтинг М., Уоллер К.Ф., Финке Дж.Высокая - по сравнению со стандартной дозой филграстима (rhG-CSF) для мобилизации клеток-предшественников периферической крови от аллогенных доноров и иммуноселекции CD34 + J Clin Oncol 1999 17 : 2160–2172

    CAS PubMed Google ученый

  • 19

    Энгельгардт М., Бертц Х., Уош Р., Финке Дж. Анализ продуктов афереза ​​стволовых клеток с использованием филграстима средней дозы плюс аферез большого объема для аллогенной трансплантации Ann Hematol 2001 80 : 201–208

    CAS PubMed Google ученый

  • 20

    Engelhardt M, Douville J, Behringer D, Jähne A, Smith A, Henschler R, Lange W.Восстановление кроветворения ex vivo перфузионная культура увеличенного костного мозга и нерасширенных предшественников периферической крови после миелоаблативной химиотерапии Трансплантация костного мозга 2001 27 : 249–259

    CAS PubMed Google ученый

  • 21

    Baum CM, Weissman IL, Tsukamoto AS, Buckle AM, Peault B. Выделение потенциальной популяции гемопоэтических стволовых клеток человека Proc Natl Acad Sci USA 1992 89 : 2804–2808

    CAS Google ученый

  • 22

    Berardi AC, Wang A, Levine JD, Lopez P, Scadden DT.Функциональная изоляция и характеристика гемопоэтических стволовых клеток человека Science 1995 267 : 104–108

    CAS Google ученый

  • 23

    Petzer AL, Hogge DE, Lansdorp PM, Reid DS, Eaves CJ. Самообновление примитивных гемопоэтических клеток человека (клетки, инициирующие длительную культуру) in vitro и их размножение в среде определения Proc Natl Acad Sci USA 1996 93 : 1470–1474

    CAS Google ученый

  • 24

    Цивин С.И., Тришманн Т., Кадан Н.С., Дэвис Дж., Нога С., Коэн К., Даффи Б., Гроневеген И., Уайли Дж., Ло П, Хардвик А., Олдхэм Ф, Джи А.Высокоочищенные CD34-положительные клетки восстанавливают кроветворение J Clin Oncol 1996 14 : 2224–2233

    CAS PubMed Google ученый

  • 25

    Ларошель А., Формор Дж., Ханенберг Х., Ван Дж. К., Бхатия М., Лапидот Т., Мердок Б., Сяо XL, Като И., Уильямс Д. А., Дик Дж. Э. Идентификация примитивных гемопоэтических клеток человека, способных репопуляции костного мозга мышей NOD / SCID: значение для генной терапии Nat Med 1996 2 : 1329–1337

    CAS Google ученый

  • 26

    Ploemacher RE, Brons NHC.Отделение CFU-S от примитивных клеток, ответственных за восстановление компартмента гемопоэтических стволовых клеток костного мозга после облучения: доказательства наличия клетки пре-CFU-S Exp Hematol 1989 17 : 263–266

    CAS PubMed Google ученый

  • 27

    Testa NG, Molineux G. Кроветворение. Практический подход IRL Press в Oxford University Press: Oxford 1993

    Google ученый

  • 28

    Ploemacher RE, Brons NHC.Клетки со способностью к репопуляции костного мозга и селезенки, а также клетки, образующие колонии селезенки на 16, 12 и 8 день, последовательно упорядочиваются на основе увеличения удерживания родамина 123 J Cell Physiol 1988 136 : 531-536

    CAS PubMed Google ученый

  • 29

    Ploemacher RE, Van der Sluijs JP, Van Beurden CAJ, Baert MRM, Chan PL. Использование долгосрочных культур костного мозга с ограниченным разведением в частотном анализе репопулирующих костный мозг и колониеобразующих гемопоэтических стволовых клеток селезенки у мышей Кровь 1991 78 : 2527–2533

    CAS Google ученый

  • 30

    Breems DA, Blokland EAW, Neben S, Ploemacher RE.Частотный анализ субпопуляций примитивных гемопоэтических стволовых клеток человека с использованием анализа клеток, образующих площадь из булыжника Лейкемия 1994 8 : 1095–1104

    CAS Google ученый

  • 31

    Sutherland HJ, Lansdorp PM, Henkelman DH, Eaves AC, Eaves CJ. Функциональная характеристика отдельных гемопоэтических стволовых клеток человека, культивируемых при ограниченном разведении на поддерживающих стромальных слоях костного мозга Proc Natl Acad Sci USA 1990 87 : 3584–3588

    CAS PubMed PubMed Central Google ученый

  • 32

    Srour EF, Zanjani ED, Cornetta K, Traycoff CM, Flake AW, Hendrick M, Brandt JE, Leemhuis T, Hoffman R.Персистенция мультилиниевых самообновляющихся лимфогематопоэтических стволовых клеток человека у химерных овец Кровь 1993 82 : 3333–3339

    CAS PubMed Google ученый

  • 33

    Дик Дж. Нормальные и лейкемические стволовые клетки человека, исследованные на мышах SCID Semin Immunol 1996 8 : 197–206

    CAS Google ученый

  • 34

    Глим Х., Эйстерер В., Ли К., Кэшман Дж., Холиок Т.Л., Николини Ф., Шульц Л.Д., фон Калле С., Ивс С.Дж.Ранее необнаруженные популяции гемопоэтических клеток человека с кратковременной репопуляционной активностью избирательно прививали NOD / SCI-β2 мышей без микроглобулина J Clin Invest 2001 107 : 199–206

    CAS PubMed PubMed Central Google ученый

  • 35

    Holyoake TL, Nicolini FE, Eaves CJ. Функциональные различия между трансплантируемыми человеческими гемопоэтическими стволовыми клетками из печени плода, пуповинной крови и костного мозга взрослого человека Exp Hematol 1999 27 : 1418–1427

    CAS PubMed Google ученый

  • 36

    Бхатия М., Боннет Д., Мердок Б., Ган О.Л., Дик Дж.Недавно открытый класс кроветворных клеток человека с SCID-репопуляционной активностью Nat Med 1998 4 : 1038–1045

    CAS Google ученый

  • 37

    Накамура Y, Андо К., Чарги Дж., Кавада Х., Сато Т, Цудзи Т, Хотта Т, Като С. Ex vivo поколение CD34 + клеток из CD34 - кроветворных клеток Кровь 1999 94 : 4053–4059

    CAS Google ученый

  • 38

    Zanjani ED, Almeide-Porada G, Livingston AG, Flake AW, Ogawa M.Человеческий костный мозг CD34 - клетки приживают in vivo и подвергаются многолинейной экспрессии, которая включает образование CD34 + клеток Exp Hematol 1998 26 : 353–360

    CAS PubMed Google ученый

  • 39

    Тиль Дж. Э., Маккалок Э. А.. Прямое измерение радиационной чувствительности нормальных клеток костного мозга мыши Radiat Res 1961 14 : 213–222

    CAS Google ученый

  • 40

    Беренсон Р.Дж., Эндрюс Р.Г., Бензингер В.И., Каламас Д.Ф., Вязальщик Дж., Бакнер С.Д., Бернштейн ID.Антиген CD34 + клетки костного мозга приживают смертельно облученных бабуинов J Clin Invest 1988 81 : 951–955

    CAS PubMed PubMed Central Google ученый

  • 41

    Доннелли Д.С., Зельтерман Д., Шаркис С., Краузе Д.С. Функциональная активность мышиных CD34 + и CD34 - популяций гемопоэтических стволовых клеток Exp Hematol 1999 27 : 788–792

    CAS PubMed Google ученый

  • 42

    ДиДжиусто Д., Чен С., Комбс Дж., Уэбб С., Намикава Р., Цукамото А., Чен Б.П., Гали АХМ.Ранние предшественники Т, В и миелоидных клеток в костном мозге плода человека обнаруживаются исключительно в популяции с высокими уровнями экспрессии CD34 Кровь 1994 84 : 421–432

    CAS PubMed Google ученый

  • 43

    Cashman JD, Lapidot T, Wang JCY, Doedens M, Schultz, Lansdorp P, Dick JE, Eaves C. Кинетическое свидетельство регенерации многолинейного гемопоэза из примитивных клеток в нормальном костном мозге человека, трансплантированного иммунодефицитным мышам Кровь 1997 89 : 4307–4316

    CAS Google ученый

  • 44

    Hogan CJ, Shpall EJ, McNulty O, McNiece I., Dick JE, Schultz LD, Keller G.Приживление и развитие обогащенных CD34 + клеток человека из пуповинной крови у мышей NOD / LtSz-scid Кровь 1997 90 : 85–96

    CAS Google ученый

  • 45

    Kawashima I, Zanjani E, Almaida-Porado G, Flake A, Zeng H, Ogawa M. CD34 + Клетки костного мозга человека, которые экспрессируют низкие уровни белка Kit, обогащены клетками с длительным приживлением костного мозга Кровь 1996 87 : 4136–4142

    CAS PubMed Google ученый

  • 46

    Srour E, Brandt J, Briddell R, Grigsby S, Leemhuis T., Hoffman R.Долгосрочная генерация и экспрессия примитивных гемопоэтических клеток-предшественников человека in vitro Кровь 1993 81 : 661–669

    CAS PubMed Google ученый

  • 47

    Сазерленд Д., Йео Е., Стюарт А., Найар Р., ДиДжусто Р., Занджани Е., Хоффман Р., Мюррей Л. Идентификация субпопуляций CD34 + после отбора гликопротеаз: приживление стволовых клеток CD34 + Thy-1 + Lin - у плодов овцы Exp Hematol 1996 24 : 795–806

    CAS PubMed Google ученый

  • 48

    Гао З., Факлер М.Дж., Леунг В., Лумкул Р., Рамирес М., Теобальд Н., Малек Х.Л., Сивин С.И.Препараты клеток CD34 + человека содержат более чем в 100 раз большую способность к приживлению мышей NOD / SCID, чем препараты клеток CD34 - Exp Hematol 2001 29 : 910–921

    CAS PubMed Google ученый

  • 49

    Goodell MA. CD34 + или CD34 - : какое это имеет значение? Кровь 1999 15 : 2545–2547

    Google ученый

  • 50

    Огава М.Изменение фенотипа гемопоэтических стволовых клеток Exp Hematol 2002 30 : 3–6

    PubMed Google ученый

  • 51

    Дао MA, Nolta JA. CD34: выбирать или не выбирать? Это вопрос Лейкемия 2000 14 : 773–776 (обзор)

    CAS PubMed Google ученый

  • 52

    Эндрюс Р.Г., Петерсон Л.Дж., Моррис Дж., Поттер Дж., Хейворд С., Гоф М., Брайант Э., Кием Х.Дифференциальное приживление генетически модифицированных субпопуляций CD34 (+) и CD34 (-) гемопоэтических клеток у смертельно облученных павианов Exp Hematol 2000 28 : 508–518

    CAS PubMed Google ученый

  • 53

    Гуделл М.А., Брозе К., Парадис Дж., Коннер А.С., Маллиган Р. Выделение и функциональные свойства гемопоэтических стволовых клеток мыши, реплицирующих in vivo J Exp Med 1996 183 : 1797–1806

    CAS PubMed PubMed Central Google ученый

  • 54

    Гуделл М.А., Розенцвейг М., Ким Х., Маркс Д., ДеМария М.А., Парадис Г., Групп С.А., Сифф Калифорния, Маллиган Р., Джонсон Р.П.Исследования оттока красителя показывают, что гемопоэтические стволовые клетки, экспрессирующие низкие или неопределяемые уровни антигена CD34, существуют у нескольких видов Nat Med 1997 3 : 1337–1345

    CAS Google ученый

  • 55

    Guo Y, Follo M, Kaiser S, Geiger K, Kapp U, Lübbert M, Engelhardt M. Выделение гемопоэтических стволовых клеток с оттоком из костного мозга, мышечной ткани и различных других источников клеток мышей и человека Кровь 2001 98 (Suppl.) : 116b – 4114

    Google ученый

  • 56

    Лю HJ, Verfaillie CM. Фенотипическая и in vitro характеристика боковой популяции Hoechst 33342 в пуповинной крови Кровь 2000 96 (Дополнение) : 664a

    Google ученый

  • 57

    Storms RW, Гуделл М.А., Фишер А., Маллиган Р., Смит К. Отток красителя Hoechst обнаруживает новый лимфоидный предшественник CD7 + CD34 - в пуповинной крови человека Кровь 2000 96 : 2125–2133

    CAS PubMed Google ученый

  • 58

    Петтенгель Р., Люфт Т, Хеншлер Р., Хоус Дж. М., Декстер Т.М., Райдер Д., Теста Н.К.Прямое сравнение путем анализа предельного разведения клеток, длительно инициирующих культивирование, в костном мозге, пуповинной крови и стволовых клетках крови Кровь 1994 84 : 3653–3659

    CAS Google ученый

  • 59

    Uchida N, Fujisaki T, карниз A, карниз C. Трансплантируемые гемопоэтические стволовые клетки в печени плода человека имеют фенотип боковой популяции (SP) CD34 + J Clin Invest 2001 108 : 1071–1077

    CAS PubMed PubMed Central Google ученый

  • 60

    Осава М., Ханада К., Хамада Х., Накачи Х.Долгосрочное лимфогематопоэтическое восстановление с помощью единичных гемопоэтических стволовых клеток с низким содержанием CD34 / отрицательных Science 1996 273 : 242–245

    CAS Google ученый

  • 61

    Morel F, Galy A, Chen B, Szilvassy SJ. Равное распределение конкурентных долгосрочных репопулирующих стволовых клеток во фракциях CD34 + и CD34 - Thy-1 low Sca-1 + клеток костного мозга Exp Hematol 1998 26 : 440–448

    CAS PubMed Google ученый

  • 62

    Сато Т., Лавер Дж. Х., Огава М.Обратимая экспрессия CD34 кроветворными стволовыми клетками мыши Кровь 1999 94 : 2548–2554

    CAS Google ученый

  • 63

    Tajima F, Sato T, Laver JH, Ogawa M. Экспрессия CD34 кроветворными стволовыми клетками мыши, мобилизованная колониестимулирующим фактором гранулоцитов Кровь 2000 96 : 1989–1993

    CAS PubMed Google ученый

  • 64

    Андо К., Накамура Ю., Чарги Дж., Мацузава Х., Цудзи Т., Като С., Хотта Т.Обширное создание стволовых клеток пуповинной крови человека CD34 + из клеток Lin - CD34 - в долгосрочной системе in vitro Exp Hematol 2000 28 : 690–699

    CAS PubMed Google ученый

  • 65

    Саммерс Ю.Дж., Хейворт С.М., Де Винтер Э.А., Чанг Дж., Теста Н.Г. Клетки пуповинной крови G0 CD34 + обладают в тысячу раз большей способностью генерировать предшественники in vitro , чем клетки G1 CD34 + Стволовые клетки 2001 19 : 505–513

    CAS PubMed Google ученый

  • 66

    Tajima F, Deguchi T, Laver JH, Zeng H, Ogawa M.Взаимная экспрессия CD38 и CD34 гемопоэтическими стволовыми клетками взрослых мышей Кровь 2001 97 : 2618–2624

    CAS Google ученый

  • 67

    Ито Т, Тадзими Ф, Огава М. Изменения в развитии экспрессии CD34 гемопоэтическими стволовыми клетками мыши Exp Hematol 2000 28 : 1269–1273

    CAS Google ученый

  • 68

    Дао MA, Nolta JA.Обратимость экспрессии CD34 на стволовых клетках человека, которые сохраняют способность к вторичному восстановлению Кровь 2000 96 (Suppl) : 581a

    Google ученый

  • 69

    Glimm H, Oh I-H, Eaves CJ. Гематопоэтические стволовые клетки человека, стимулированные к пролиферации in vitro , теряют потенциал приживления во время транзита S / G2 / M и не попадают повторно в G0 Кровь 2000 96 : 4185–4193

    CAS Google ученый

  • 70

    Verfaillie CM, Almaida-Porada G, Wissink S, Zanjani ED.Кинетика приживления клеток CD34 - и CD34 + из мобилизованной крови отличается от таковой для клеток CD34 - и CD34 + из костного мозга Exp Hematol 2000 28 : 1071-1079

    CAS PubMed Google ученый

  • 71

    Morrison SJ, Weissman IL. Подмножество долгосрочных репопуляций гемопоэтических стволовых клеток детерминировано и может быть выделено по фенотипу Иммунитет 1994 1 : 6611–6673

    Google ученый

  • 72

    Magli MC, Искове Н.Н., Одарченко Н.Преходящий характер ранних гемопоэтических колоний селезенки Природа 1982 295 : 527–529

    CAS PubMed Google ученый

  • 73

    Кондо М., Вайсман Иллинойс, Акаши К. Идентификация клоногенных общих лимфоидных предшественников в костном мозге мышей Клетка 1997 91 : 661–672

    CAS Google ученый

  • 74

    Акаси К., Травер Д., Миямото Т., Вайсманн Иллинойс.Клоногенный общий миелоидный предшественник, дающий начало всем миелоидным линиям Nature 2000 404 : 193–197

    CAS Google ученый

  • 75

    Карниз AC, Карниз CJ. Контроль роста при лейкемии Prog Clin Biol Res 1990 354 : 223–236

    Google ученый

  • 76

    Джексон К.А., Ми Т., Гуделл Массачусетс. Гематопоэтический потенциал стволовых клеток, выделенных из скелетных мышц мышей Proc Natl Acad Sci USA 1999 96 : 14482–14486

    CAS Google ученый

  • 77

    Джексон К.А., Майка С.М., Ван Х., Поциус Дж., Хартли С.Дж., Мажески М.В., Энтман М.Л., Майкл Л.Х., Хирши К.К., Гуделл М.А.Регенерация ишемической сердечной мышцы и эндотелия сосудов взрослыми стволовыми клетками J Clin Invest 2001 107 : 1395–1402

    CAS PubMed PubMed Central Google ученый

  • 78

    Goodell MA. Стволовые клетки: есть ли будущее у пластика? Curr Opin Cell Biol 2001 13 : 662–665

    CAS PubMed Google ученый

  • 79

    Horwitz EM, Prockop DJ, Fitzpatrick LA, Koo WWK, Gordon PL, Neel M, Sussman M, Orchard P, Marx JC, Pyeritz RE, Brenner MK.Трансплантируемость и терапевтические эффекты мезенхимальных клеток костного мозга у детей с несовершенным остеогенезом Nat Med 1999 5 : 309–313

    CAS PubMed PubMed Central Google ученый

  • 80

    Петерсен Б.Е., Боуэн В.С., Патрен К.Д., Марс В.М., Салливан А.К., Мурас Н., Боггс С.С., Гринбергер Дж. С., Гофф Дж. Костный мозг как потенциальный источник овальных клеток печени Science 1999 284 : 1168–1170

    CAS PubMed PubMed Central Google ученый

  • 81

    Макино С., Фукуда К., Миёси С., Кониси Ф, Кодама Х, Пан Дж, Сно М, Такахаши Т., Хори С., Абэ Х, Хата Дж, Умедзава А., Огава С.Кардиомиоциты могут быть получены из клеток костного мозга in vitro J Clin Invest 1999 103 : 697–705

    CAS PubMed PubMed Central Google ученый

  • 82

    Mezey E, Chandross KJ, Harta G, Maki RA, McKercher SR. Превращение крови в мозг: клетки, несущие нейрональные антигены, генерировали in vivo из костного мозга Science 2000 290 : 1779–1782

    CAS Google ученый

  • 83

    Brazelton TR, Rossi FM, Keshet GI, Blau HM.От костного мозга к мозгу: экспрессия нейрональных фенотипов у взрослых мышей Science 2000 290 : 1775–1779

    CAS PubMed PubMed Central Google ученый

  • 84

    Bjornson CRR, Rietze RL, Reynolds BA, Magli MC, Vescovi AL. Превращение мозга в кровь: гемопоэтическая судьба, принятая взрослыми нейрональными стволовыми клетками in vivo Science 1999 283 : 534–537

    CAS PubMed PubMed Central Google ученый

  • CD34: Выбирать или не выбирать? Это вопрос

    Белок клеточной поверхности CD34 часто используется в качестве маркера для положительной селекции приживления гемопоэтических стволовых клеток и клеток-предшественников человека как в исследованиях, так и при клинической трансплантации.Было проведено много успешных трансплантаций с клетками, обогащенными CD34, и пациенты быстро прижились и продолжают чувствовать себя хорошо спустя годы. инокулят трансплантата, зрелые Т-лимфоциты, которые могут вызывать реакцию «трансплантат против хозяина», могут быть истощены на несколько логарифмов, а инокулят трансплантата может быть удален путем удаления зрелых клеток до трансдукции ex vivo для применения в генной терапии.12345678910

    Ощущение неопределенности относительно того, может ли отбор клеток, экспрессирующих CD34 для трансплантации, исключать другую популяцию примитивных стволовых клеток, лишенных экспрессии CD34, впервые возникло в 1996 году. В том же году Осава и его коллеги опубликовали исследование, в котором определялась CD34-отрицательные мышиные клетки, которые обладали полной способностью к приживлению.11 Хотя это исследование было чрезвычайно важным и интересным, оно было проведено на мышах, и корреляция между мышиным и человеческим CD34 не была установлена.

    Первое доказательство того, что существует человеческий коррелят с прививкой мышиных стволовых клеток CD34 - , было опубликовано Бхатией и др. в 1998 году. Мыши SCID, эта группа исследователей продемонстрировала низкий уровень приживления и кроветворной способности в человеческих клетках CD34 . Хотя это было очень хорошо проведенное и интересное исследование, клетки CD34 с способностью к приживлению встречались крайне редко, а уровни приживления у мышей NOD / SCID были очень низкими; намного ниже, чем то, что можно было бы получить с использованием эквивалентного количества клеток из популяции CD34 + .Связь между CD34-положительными и отрицательными популяциями все еще не ясна, но определенно требует дальнейшего изучения.

    В то время как Бхатиа и др. завершали свои исследования стволовых клеток CD34 -, Гуделл и его коллеги13 работали над дальнейшей характеристикой примитивной популяции клеток, которую они идентифицировали у мышей, обезьян и человека, исключая Хехста. 33342 краситель. Считается, что эта популяция имеет высокую экспрессию MDR или MDR-подобных молекул, мембранных насосов, исключающих лекарственные препараты, красителей Hoechst и токсинов из гемопоэтических стволовых клеток.Исключающие клетки Hoechst были названы «боковой популяцией», или SP, из-за их расположения в нижнем левом квадранте графика Hoechst FACS, считываемого с двумя разными длинами волн. Интересно отметить, что Гуделл и его коллеги совсем недавно сообщили, что «побочная популяция» Hoechst, за исключением сателлитных клеток, выделенных из скелетных мышц, обладает способностью к восстановлению кроветворения, 14 подтверждая, что они являются очень примитивными, незафиксированными стволовыми клетками. В 1997 году Гуделл с соавторами15 сообщили, что SP-клетки, выделенные из костного мозга мыши, которые исключили большую часть красителя Hoechst, фактически лишены экспрессии CD34 на клеточной поверхности и обладают значительной способностью к восстановлению кроветворения с генерацией CD34 . + сот.15 SP-клетки присутствовали в небольших количествах, и приживление человеческой фракции SP CD34 - у иммунодефицитных мышей на тот момент еще не изучалось. Поэтому, хотя статьи SP вызвали много ажиотажа и дискуссий, большинство пересадчиков клеток CD34 + еще не беспокоились о том, что они могут исключить ценную популяцию при сортировке.

    Эти опасения начали проявляться, когда недавно была опубликована очень точная статья, объясняющая больше биологии популяций клеток CD34 и CD34 + .16 Это исследование, проведенное лабораторией Огавы, продемонстрировало, что мышиные стволовые клетки CD34 могут быть индуцированы экспрессировать CD34 и увеличивать способность приживления после обработки in vivo мышей 5-фторурацилом. Сато и др. выдвинули гипотезу о том, что стволовые клетки CD34 - существуют в крайне неподвижном состоянии и что активация необходима для усиления экспрессии и индукции CD34 до состояния, при котором мышь-реципиент легче приживается.В исследованиях, проведенных их группой, этой активации способствовала обработка in vivo мышей-доноров 5-ФУ.

    «Активация», на которую ссылаются Огава и его коллеги, вряд ли будет просто индукцией клеточного цикла, которая может быть вызвана привлечением примитивных гемопоэтических стволовых клеток в цикл для восстановления гемопоэза у животных, получавших 5-ФУ. Можно идентифицировать гемопоэтические клетки человека, которые экспрессируют высокие уровни CD34, но в то же время очень неподвижны, 1718 не может быть легко индуцирован в клеточный цикл цитокинами, 171920 и у них отсутствует экспрессия маркера Ki67, что указывает на то, что они находятся в фазе G 0 клеточного цикла.212223 Наша лаборатория недавно продемонстрировала, что высоко покоящиеся человеческие клетки CD34 + могут быть индуцированы в цикл за счет снижения количества ингибиторов циклинзависимой киназы, 23 но не было соразмерных изменений в уровнях экспрессии CD34, когда клетки вошли в цикл (Dao и Нолта, неопубликованные данные). Предполагаемые «активирующие» факторы, регулирующие индукцию экспрессии CD34 у мышей Огавы, получавших 5-ФУ, в настоящее время остаются неизвестными.

    Krause et al. , 2425 из Йельского университета подробно охарактеризовали мышиный промотор CD34 и определяют, какие факторы транскрипции действуют как положительные и отрицательные регуляторы.Эти типы исследований дадут нам ключ к разгадке того, какие сигнальные пути могут индуцировать экспрессию CD34. Другие интересные исследования были проведены Fackler и др. , 26 из Медицинской школы Джона Хопкинса, которые продемонстрировали, что фосфорилирование предварительно сформированного белка CD34 будет определять, будет ли он экспрессироваться на поверхности клетки или оставаться внутри клетки. Эти исследования показывают важность того, чтобы не полагаться на данные FACS для экспрессии CD34 на клеточной поверхности, чтобы определить, действительно ли популяции являются CD34 + по сравнению с CD34 -.Анализы для оценки уровней мРНК CD34 и внутриклеточного белка также должны быть выполнены, чтобы определить, присутствует ли CD34, но еще не локализован на поверхности клетки. Однако важным моментом является то, что клетки, которые имеют мРНК CD34 и внутриклеточный белок CD34, но не имеют экспрессии на клеточной поверхности, не будут приобретены для трансплантации в устройстве «положительной селекции CD34». До сих пор устройства отбора для выделения клеток CD34 + не были высокоэффективными, при этом зарегистрированные уровни составляли в среднем от 40 до 75% клеток CD34 + в конечном продукте, который переливали пациентам.Следовательно, вероятность того, что «заражающие» клетки CD34 были включены в трансплантации, проведенные на сегодняшний день, высока. Однако существует тенденция к попыткам повысить чистоту конечного продукта, поэтому следует обратить внимание на важность включения стволовых клеток CD34 .

    Интересное наблюдение было сделано в отношении экспрессии человеческого CD34 или ее отсутствия в нашей лаборатории. Используя модель ксенотрансплантата bnx / hu, в которой гемопоэз человека можно изучать в течение 18 месяцев, 272823233 мы обнаружили, что существуют человеческие клетки с обширной колониеобразующей и долгосрочной способностью инициировать культивирование, которые восстанавливаются из костного мозга в течение длительного периода времени. недоношенные животные (рис. 1).Эти клетки абсолютно лишены экспрессии CD34 на клеточной поверхности при выделении от мышей (Дао и Нолта, неопубликованные данные). В настоящее время мы находимся в процессе определения того, содержат ли клетки внутриклеточный белок CD34 или сообщение CD34, и обладают ли эти клетки способностью к репопуляции в исследованиях вторичной трансплантации. В соответствии с нашим наблюдением, Сато и др. 16 элегантно продемонстрировали, что мышиные клетки CD34 + могут возвращаться к фенотипу CD34 - после трансплантации и сохранять вторичную, многолинейную способность приживления.Возможность того, что человеческие клетки CD34 + и CD34 - также могут быть «взаимопревращаемыми», обсуждается Гуделлом в заставляющем задуматься предисловии к статье Сато. костный мозг мышей bnx с длительной трансплантацией лишен экспрессии CD34 на клеточной поверхности, но сохраняет значительную регенеративную способность.

    Используя другую модель долгосрочного ксенотрансплантата, преиммунную эмбриональную овечью систему, Занджани и его коллеги3536 продемонстрировали, что человеческие CD34 - / линия - обладают способностью к многократному восстановлению и могут давать CD34 + клеток в vivo .Civin и др. утверждают, что контаминация затуманила результаты, опубликованные в литературе для CD34-отрицательных клеток. Их отчет на собрании Американского общества гематологии (ASH) в 1999 г. продемонстрировал, что крошечное количество клеток CD34 + , загрязняющих популяции CD34 - , может быть объяснением всех полученных результатов, тем более что уровни приживления, сообщенные к тому моменту. были очень низкими ( Кровь 1999; 94 ; 30a).Они получили очень низкие уровни приживления при трансплантации высокоочищенных популяций CD34 / lin . Однако окончательный отчет Накамуры и др. , 37, описанный ниже, продемонстрировал, что свежевыделенные человеческие клетки CD34 - действительно обладают очень низкой способностью к приживлению, как измерено в системе ксенотрансплантатов NOD / SCID, но будут генерировать CD34 + . стволовые клетки с улучшенной способностью к приживлению после культивирования in vitro .

    Накамура и др. 37 продемонстрировали, что взаимосвязь между стволовыми клетками CD34 - и CD34 + , аналогичная той, которую описал Сато и др. 16 у мышей, также существует у человека.Они показали, что высокоочищенные человеческие CD34 , линия , культивированные с цитокинами в течение 7 дней на линии стромальных клеток мышей HESS-5, увеличивали и повышали экспрессию CD34.37. Это исследование представляет собой первый окончательный анализ индукции in vitro. экспрессии CD34 в популяции CD34 - в клетках человека. Расширенные клетки CD34 + имели способность приживления мыши CFU, LTCIC и NOD / SCID. Приживление клеток человека у мышей с иммунодефицитом было многолинейным, хотя развитие Т-лимфоцитов не может быть определено у мышей NOD / SCID.Наша лаборатория находится в процессе определения потенциала развития Т-лимфоцитов из клеток CD34 - , линия - в новом штамме мышей с иммунодефицитом, nude / NOD / SCID, о котором мы сообщили на встрече ASH в этом году ( Кровь 1999; 94: 9a; Кровь 1999; 94 : 129a). Количество гемопоэтических клеток человека, образованных из размноженных клеток CD34 - («индуцированных CD34» клеток) в исследовании Накамуры и др. , было намного выше, чем то, что может быть достигнуто путем трансплантации свежевыделенных клеток CD34 -. в мышей NOD / SCID, как показано в исследовании Bhatia et al .12 Fujisaki и др. 38 достигли дифференциации человеческих CD34 - CD38 - lin - клеток in vitro для генерации колониеобразующих клеток-предшественников и низкого количества клеток CD34 + , но результирующих популяций у мышей с иммунодефицитом все еще было плохое приживление. Дополнительные исследования для определения различий, существующих между CD34 - , CD34 + и «индуцированными CD34» гемопоэтическими стволовыми клетками человека, позволят определить, лежит ли разница в способности восстановления на уровне самонаведения, выживания или размножения (рис. 2).

    Рисунок 2

    CD34-отрицательные клетки из пуповинной крови человека плохо приживаются у мышей с иммунодефицитом, пока они не активируются культурой ex vivo, генерируя CD34 + , а также клетки CD34 -.

    После просмотра исследования Накамуры и др. , 37 большинство наших коллег были убеждены, что существует клетка пре-CD34 + , которую следует, по крайней мере, рассматривать для включения в трансплантацию костного мозга. Биология стволовых клеток CD34 - человека еще не определена, но способность давать начало большому количеству клеток CD34 + , которые могут опосредовать восстановление, предполагает, что это важно.Следует ли включать эту клетку в клиническую трансплантацию костного мозга или достаточно лишь фракции, экспрессирующей CD34, - еще предстоит выяснить. Многим пациентам были приживлены клетки CD34 + , они имеют многолинейное приживление и не проявляют абсолютно никаких признаков снижения гемопоэза через несколько лет после трансплантации. Тем не менее, Verfaillie, Zanjani и коллеги сообщили об очень наводящем на размышления исследовании на встрече ASH в 1999 году. Они продемонстрировали, что стволовые клетки CD34 - не так легко истощаются, как стволовые клетки CD34 + , в модели серийной трансплантации доиммунного эмбриона овцы ( Blood 1999; 94 : 133a).Если два фенотипа являются «свободно взаимопревращаемыми», как предполагает Гуделл 34, трансплантация очищенных клеток CD34 + создаст пул клеток CD34. Однако, если человеческие клетки CD34 - являются резервуаром для продукции клеток CD34 + и обладают более длительной или более устойчивой способностью к восстановлению, как было предложено в недавней работе лабораторий Занджани и Верфайли, их не следует исключать из клинической практики. трансплантация.

    Исследования, описанные в текущем обзоре, изменили отношение сообщества гемопоэза с умеренного интереса к этой предполагаемой «другой стволовой клетке» к сильному любопытству и вызывают повторение вопросов, «какие стволовые клетки должны мы трансплантируем? »и« выбирать или не выбирать? »В настоящее время кажется наиболее разумным изучить и разработать методы, которые будут истощать зрелые, положительные по клонам клетки, сохраняя при этом незафиксированные гемопоэтические стволовые клетки человека, которые делают и не экспрессируют CD34.Существуют методы выделения этих незарегистрированных клеток для исследования, включая системы отбора AC133 от Miltenyi Biotech (Оберн, Калифорния, США) и Stem Sep Columns для истощения клон-положительных клеток от Stem Cell Technologies (Ванкувер, Британская Колумбия). Надеюсь, вскоре мы увидим, что эти системы будут одобрены для использования в клинической трансплантации.

    Антитело к CD34 [9B10D4 / 4H5E7] (ab54208) | Abcam

    Обзор

    • Название продукта

    • Описание

      Мышь моноклональная [9B10D4 / 4H5E7] к CD34

    • Вид-хозяин

      Мышь

    • Протестированные приложения

    • Активность видов

      Реагирует с: Человек, рекомбинантный фрагмент

    • Иммуноген

      Рекомбинантный полноразмерный белок, соответствующий CD34 человека.

    • Положительный контроль

      • IF: Периферические клетки крови. WB: рекомбинантный белок CD34
    • Общие примечания

      Этот продукт был изменен с асцита на супернатант. Лот № с высоким содержанием GR182422-21 взят из супернатанта тканевой культуры

      В течение ряда лет отрасль наук о жизни находится в тисках кризиса воспроизводимости.Abcam лидирует в решении этой проблемы с нашим ассортиментом рекомбинантных моноклональных антител и нокаут-отредактированными клеточными линиями для проверки на золотой стандарт. Перед покупкой убедитесь, что этот продукт соответствует вашим потребностям.

      Если у вас есть какие-либо вопросы, особые требования или проблемы, отправьте нам запрос и / или свяжитесь с нашей службой поддержки перед покупкой. Рекомендуемые альтернативы для этого продукта можно найти ниже вместе с публикациями, отзывами клиентов и вопросами и ответами

      .

    Недвижимость

    • Форма

      Жидкость

    • Инструкция по хранению

      Поставляется при 4 ° C.После доставки аликвотируйте и храните при -20 ° C. Избегайте циклов замораживания / оттаивания.

    • Буфер памяти

      Консервант: 0,05% азид натрия
      Состав: PBS

    • Загрузка информации о концентрации ...
    • Чистота

      Протеин G очищенный

    • Примечания по очистке

      Очищено от супернатанта тканевой культуры.

    • Клональность

      Моноклональный

    • Клонирующий номер

      9B10D4 / 4H5E7

    • Изотип

      IgG2b

    • Направления исследований

    Сопутствующие товары

    • Совместимые вторичные компоненты

    • Наборы для конъюгации

    • Изотипический контроль

    • Рекомбинантный белок

    Приложения

    Гарантия Abpromise

    Наша гарантия Abpromise распространяется на использование ab54208 в следующих протестированных приложениях.

    Примечания по применению включают рекомендуемые начальные разведения; Оптимальные разведения / концентрации должны определяться конечным пользователем.

    Приложение Отзывы Банкноты
    WB

    1/200 - 1/1000. Обнаруживает полосу приблизительно 35 кДа (расчетная молекулярная масса: 41 кДа).

    ICC / IF (1)

    1/100 - 1/500.

    Flow Cyt Используйте 1 мкг на 10 6 клеток.

    ab170192 - мышиный моноклональный IgG2b, подходит для использования в качестве изотипического контроля с этим антителом.

    IHC-P

    Использование при концентрации, зависящей от анализа.

    Примечания

    WB
    1/200 - 1/1000. Обнаруживает полосу приблизительно 35 кДа (расчетная молекулярная масса: 41 кДа).

    ICC / IF
    1/100 - 1/500.

    Flow Cyt
    Используйте 1 мкг для 10 6 клеток.

    ab170192 - мышиный моноклональный IgG2b, подходит для использования в качестве изотипического контроля с этим антителом.

    IHC-P
    Использование при концентрации, зависящей от анализа.

    Цель

    • Функция

      Возможная молекула адгезии, играющая роль в раннем гематопоэзе, опосредуя прикрепление стволовых клеток к внеклеточному матриксу костного мозга или непосредственно к стромальным клеткам.Может действовать как каркас для прикрепления гликанов, специфичных для клонов, позволяя стволовым клеткам связываться с лектинами, экспрессируемыми стромальными клетками или другими компонентами костного мозга. Представлены углеводные лиганды для селектинов.

    • Тканевая специфичность

      Селективно экспрессируется на гематопоэтических клетках-предшественниках и эндотелии мелких сосудов различных тканей.

    • Сходства последовательностей

      Принадлежит к семейству CD34.

    • Стадия развития

      О ранних гемопоэтических клетках-предшественниках.

    • Посттрансляционные


      модификации

      Сильно гликозилированный.
      Фосфорилирован по сериновым остаткам с помощью PKC.

    • Сотовая локализация

      Мембрана.

    • Информация от UniProt
    • Ссылки на базу данных

    • Альтернативные названия

      • антитело к CD34
      • Антиген CD34 антитело
      • Молекула CD34 антитело
      • CD34_HUMAN антитела
      • Обозначение кластера 34 антитело
      • кластер дифференцировки 34 антитело
      • Антитело к CD34 к антигену кроветворных клеток-предшественников
      • Антитело против HPCA1
      • Антитело к мукозиалину
      • OTTHUMP00000034733 антитело
      • OTTHUMP00000034734 антитело

      посмотреть все

    Листы данных и документы

    • SDS скачать

      Страна / регион Выберите страну / регион

      Язык Выбор языка

    • Скачать брошюру

    Список литературы (7)

    ab54208 упоминается в 7 публикациях.

    • Горкун А.А. и др. Дуэт остеогенной и ангиогенной дифференцировки в сфероидах, полученных из ADSC. Front Cell Dev Biol 9: 572727 (2021). PubMed: 33898413
    • D'Onofrio N et al. MicroRNA-33 и SIRT1 влияют на бремя коронарных тромбов у пациентов с гипергликемией ИМпST. J. Cell Physiol 235: 1438-1452 (2020). PubMed: 31294459
    • Vaidya A et al. Химерные питатели мезенхимальных стромальных клеток и стромальных клеток, модифицированных конститутивно активным AKT, увеличивают кроветворные стволовые клетки. Regen Med 14: 535-553 (2019). PubMed: 31115264
    • Cao W et al. Twist1 способствует развитию астроцитомы, стимулируя васкулогенную мимикрию. Oncol Lett 18: 846-855 (2019). PubMed: 31289562
    • Zhulyn O & Hui CC Sufu и Kif7 в формировании паттерна конечностей и развитии. Dev Dyn 244: 468-78 (2015). PubMed: 25581370
    • Fu S et al. Телоциты при фиброзе печени человека. J Cell Mol Med 19: 676-83 (2015). PubMed: 25661250
    • Zhou Q et al. Сердечные телоциты дважды положительны по CD34 / PDGFR-a. J Cell Mol Med 19: 2036-42 (2015). IHC ; Человек . PubMed: 26082061

    Отзывы и ответы клиентов

    1 - 2 из 2 Обзоры или вопросы и ответы

    Просмотров: 10Просмотров: 50Просмотров: 100Сортировать по: Наивысшим голосам Сортировать по: Наименьшим голосам Сортировать по: Новейшим Первым Сортировать: Старым Первым

    Приложение

    Иммуноцитохимия / иммунофлуоресценция

    Образец

    Клетка человека (Mel 30)

    Шаг блокировки

    Сыворотка как блокирующий агент на 30 минут · Концентрация: 1% · Температура: 20 ° C

    Фиксирующий

    Параформальдегид

    РС.Беате Тоде

    Проверенный клиент

    Отправлено 20 фев 2013 г.

    Спасибо за ваш запрос.
    Иммуноген, используемый для генерации ab54208, представлял собой очищенный усеченный рекомбинантный CD34 человека, очищенный Ni-NTA, экспрессируемый в E.Coli штамма BL21 со следующей последовательностью:

    MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCA Эпитоп это антитело является обязательным дополнительно не отображается.
    Я надеюсь, что эта информация окажется полезной, и желаю удачи в ваших экспериментах.

    Подробнее

    Транскриптом человеческих CD34 + гемопоэтических стволовых клеток-предшественников

    Реферат

    Изучение экспрессии генов на разных стадиях кроветворения дает возможность понять генетические основы кроветворения.Мы проанализировали экспрессию генов в человеческих гематопоэтических клетках CD34 + , которые представляют популяцию стволовых клеток-предшественников (клетки CD34 + ). Мы собрали> 459000 сигнатур транскриптов из клеток CD34 + , включая сгенерированные de novo 3'-EST и существующие последовательности полноразмерных кДНК, EST и серийный анализ тегов экспрессии генов (SAGE), а также выполнили обширную аннотацию. на этом большом наборе последовательностей транскриптов CD34 + . Мы определили гены, экспрессируемые в клетках CD34 + , проверили известные гены и идентифицировали новые гены различных функциональных категорий, участвующих в гематопоэзе, проанализировали альтернативную экспрессию генов, включая альтернативную инициацию транскрипции, сплайсинг и аденилирование, идентифицировали антисмысловые и некодирующие транскрипты. , определили сигнатуру экспрессии специфичного для клеток гена CD34 + и разработали карту транскрипции клеток CD34 + в геноме человека.Наше исследование дает современный взгляд на экспрессию генов в человеческих клетках CD34 + и показывает, что ранний гематопоэз - это организованный процесс, в котором участвует более половины человеческих генов, выполняющих различные функции. Данные, полученные в результате нашего исследования, обеспечивают исчерпывающий и единообразный ресурс для изучения гемопоэза и биологии стволовых клеток.

    Кроветворение - это динамический процесс. Гемопоэтические стволовые клетки, образующиеся в вентральной мезодерме на эмбриональной стадии, постепенно мигрируют в желточный мешок, область аорты, плаценту, печень плода и костный мозг у взрослых.Во время этого процесса гемопоэтические стволовые клетки воспроизводятся путем самообновления и дифференцируются в мультипотентных предшественников, предшественников с ограниченным клонированием и, в конечном итоге, в зрелые типы клеток: эритроидные клетки, тромбоциты, миелоидные клетки, моноциты, NK-клетки, Т-клетки, и B-клетки периферического кровообращения для выполнения определенных функций (1). CD34, гликопротеин клеточной мембраны, является специфическим маркером гемопоэтических клеток, дифференцированных на стадии стволовых клеток-предшественников у людей и других видов млекопитающих (2, 3).Кроветворные стволовые клетки-предшественники CD34 + (далее называемые клетками CD34 + ) необходимы для поддержания всей кроветворной системы и широко используются в клинической практике для восстановления кроветворной системы посредством трансплантации костного мозга для лечения различных заболеваний (4 ). Функциональная важность клеток CD34 + привлекла большое внимание для определения генетической основы клеток CD34 + , что подтверждается анализом экспрессии генов в клетках CD34 + с увеличенным объемом и идентификацией нескольких генов и путей, связанных с CD34 . + клеточное самообновление и дифференцировка кроветворения (5–15).Однако существующие знания об экспрессии генов в клетках CD34 + не являются исчерпывающими, поскольку используемые технологии ограничены, полученные данные фракционируются в отдельных исследованиях и не имеют последовательной аннотации с текущей информацией о геноме, а также количеством генов, задействованных в качестве ключевых генов. связанных с клетками CD34 + , остается очень ограниченным.

    Чтобы получить более полное представление о генетической основе человеческих клеток CD34 + , мы выполнили интегрированный анализ транскриптома на человеческих клетках CD34 + .Мы создали большой набор данных последовательностей транскриптов из человеческих клеток CD34 + . Наш обширный информационный анализ данных последовательностей раскрывает много новой информации об экспрессии генов в клетках CD34 + и обеспечивает текущее представление об экспрессии генов в клетках CD34 + , а также представляет собой всеобъемлющий и единообразный ресурс для изучения гематопоэза и биологии стволовых клеток.

    Результаты

    Последовательности транскриптов CD34

    + .

    Поскольку клетки CD34 + были идентифицированы как представляющие гемопоэтические стволовые клетки-предшественники, продолжающиеся усилия позволили идентифицировать гены, экспрессируемые в этих клетках, со значительным прогрессом.Однако из-за ограничений технологий существующих данных недостаточно для покрытия транскриптома CD34 + . Мы использовали следующие 2 подхода для максимального сбора последовательностей транскриптов из клеток CD34 + :

    1. De novo CD34 + 3 'сбор EST: мы выполнили крупномасштабный сбор CD34 + 3' EST из нормальных гематопоэтических клеток человека CD34 + , используя высокопроизводительную генерацию длинных последовательностей на основе серийного анализа гена. экспрессии (SAGE) для метода идентификации генов (GLGI) (16, 17).Используя теги SAGE в качестве смысловых праймеров для ПЦР, GLGI преобразует теги SAGE в 3'-EST. Из 10 000 новых тегов SAGE, полученных в предыдущем исследовании CD34 + (12), мы сгенерировали 25 798 высококачественных 3 'EST. Это самая большая коллекция EST из клеток CD34 + человека и одна из крупнейших коллекций EST из клеток одного типа человека с использованием системы секвенирования Sanger (http://www.ncbi.nlm.nih.gov/UniGene/lbrowse2. cgi? TAXID = 9606).

    2. Собранные существующие последовательности мРНК CD34 + : Мы провели анализ базы данных и литературы, чтобы идентифицировать общедоступные последовательности мРНК, происходящие из человеческих клеток CD34 + .К ним относятся полноразмерные последовательности кДНК (8), 5 'и 3' EST (7, 8, 16), теги SAGE длиной 21 п.н. (15) и теги SAGE длиной 14 п.н. (10, 13). Чтобы гарантировать, что информация, полученная в результате исследования, представляет собой нормальный транскриптом CD34 + , мы использовали только последовательности, полученные из нормальных первичных клеток CD34 + .

    Всего 459 482 сигнатуры транскрипта CD34 + были идентифицированы с помощью этих процессов (таблица 1, набор данных S1). Они представляют собой достижение идентификации транскриптов CD34 + за последнее десятилетие с использованием системы секвенирования Сэнгера и обеспечивают прочную основу для исчерпывающей аннотации транскриптомов CD34 + .

    Таблица 1.

    Источники последовательностей и гены, идентифицированные в клетках CD34 +

    Гены, экспрессируемые в клетках CD34

    + .

    Мы сравнили последовательности транскриптов CD34 + с 22 828 генами человека, включая 18 013 генов человека, представленных 26 829 последовательностями мРНК RefSeq, и 14 129 генами человека, представленными в справочной базе данных SAGEmap. Всего 12759 (56%) человеческих генов соответствовали 221 017 последовательностям транскриптов CD34 + (таблица 1, набор данных S2), что указывает на то, что более половины человеческих генов экспрессируются в клетках CD34 + .

    Функциональные категории генов, экспрессируемых в клетках CD34

    + .

    Используя справочную базу данных Gene Ontology (18), мы выполнили глобальную функциональную классификацию генов, экспрессируемых в клетках CD34 + (набор данных S3). В категории «Клеточный компонент» чаще всего экспрессировались гены, вовлеченные в «клетку», «часть клетки», «органеллу» и «часть органеллы»; в категории «Биологический процесс» чаще всего экспрессировались гены, участвующие в «клеточном процессе», «метаболическом процессе», «биологической регуляции» и «экспрессии генов»; в категории «Молекулярная функция» чаще всего экспрессировались гены, участвующие в «связывании», «каталитической активности», «активности молекулярного преобразователя» и «активности регулятора транскрипции».«Широкие функциональные категории подразумевают, что клетки CD34 + выполняют многие основные биологические активности.

    Далее мы охарактеризовали несколько групп функционально важных генов, относящихся к гемопоэзу.

    гена, участвующего в самообновлении стволовых клеток.

    Было ясно продемонстрировано, что группа генов контролирует самообновление гемопоэтических стволовых клеток (5, 19). Эти гены включают факторы роста, факторы ассоциации хроматина, гены гомеобокса, факторы транскрипции и регуляторы клеточного цикла.Поиск в списке генов CD34 + показывает, что было обнаружено 59 таких генов (набор данных S4 A ). MYB - важный фактор транскрипции для гемопоэза. Он был обнаружен с помощью 12 EST, 6 тегов SAGE (33 копии) и 1 тега longSAGE (13 копий), что указывает на присутствие множества изоформ транскриптов этого гена в клетках CD34 + . MLL , гомолог Drosophila trithorax, метилирует гистон h4K4 и регулирует экспрессию многих генов развития, включая гены HOX .Он часто вызывает острый лейкоз из-за хромосомной транслокации. Пять изоформ MLL были обнаружены в клетках CD34 + , из которых 4 были обнаружены с помощью тегов EST и SAGE. Гены HOX являются главными регуляторами клеточной дифференцировки. Из 39 генов человека HOX 14 были обнаружены в клетках CD34 + . Из этих 14 генов HOXA9 , HOXA10 и HOXB4 являются известными регуляторами кроветворения, а остальные 11 были обнаружены недавно.

    генов факторов транскрипции.

    Факторы транскрипции жизненно важны для регуляции экспрессии генов. Сравнение 1023 генов факторов транскрипции человека, сгруппированных в 220 семейств факторов транскрипции, показало, что 574 (56%) гена факторов транскрипции были экспрессированы в клетках CD34 + (Dataser S4 B ). Эти 574 гена были распределены в 197 (90%) семействах транскрипционных факторов (таблица 2, набор данных S4 C ). zf-C2h3, семейство белков «цинковые пальцы», содержит наибольшее количество генов из всех семейств генов; из 574 обнаруженных генов 327 принадлежат к этому семейству.

    Таблица 2.

    Гены фактора транскрипции, сигнала и киназы в клетках CD34 +

    гены передачи сигналов.

    Мы провели поиск по списку генов CD34 + , чтобы идентифицировать гены, участвующие в путях передачи сигнала, и идентифицировали гены, участвующие по крайней мере в 10 путях (таблица 2, набор данных S5 A ). Хорошо известно, что пути Notch , Wnt и TGFB регулируют самообновление и дифференцировку кроветворения (5).Было обнаружено множество генов, участвующих в этих путях (набор данных S5 B ). Примером может служить SMAD3 , ген, участвующий в пути WNT. Он был обнаружен с помощью полноразмерных тегов кДНК, EST и SAGE. Также было обнаружено больше генов, участвующих в других путях передачи сигнала. Например, из 79 известных генов в системе передачи сигналов фосфатидилинозита 63 были обнаружены в клетках CD34 + .

    киназных генов.

    Протеинкиназы играют важную роль в регулировании широкого спектра биологических активностей.Из 620 известных генов киназ человека (20) 94 были обнаружены в клетках CD34 + (таблица 2, набор данных S5 C – E ), включая 19% генов тирозинкиназ. FLT3 представляет собой рецепторную тирозинкиназу, которая регулирует самообновление гемопоэтических стволовых клеток, и она часто мутирует при остром миелоидном лейкозе. Исследования на клетках мыши и человека не определили специфические стадии кроветворения для экспрессии FLT3 (21). Обнаружение транскриптов FLT3 с помощью EST и longSAGE в клетках CD34 + указывает на то, что FLT3 экспрессируется на стадиях ствол-предшественник.Интересно, что ни один из 8 генов киназ, принадлежащих рецепторной гуанилатциклазе, не был обнаружен в клетках CD34 + . Остается определить, не играет ли этот тип киназы никакой роли в раннем гематопоэзе.

    генов микроРНК.

    Данные показывают, что микроРНК участвуют в регуляции кроветворения (22, 23). Первичные транскрипты микроРНК процессируются с помощью 5'-кэппинга и 3'-полиаденилирования в предшественники перед тем, как они будут преобразованы в зрелую микроРНК (24).Сопоставление CD34 + EST и тегов SAGE с известными последовательностями предшественников микроРНК человека позволяет идентифицировать 45 микроРНК, экспрессируемых в клетках CD34 + , большинство из которых, как известно, не связаны с гемопоэзом (набор данных S6 A – C ). Несколько предшественников микроРНК присутствуют на высоких уровнях, такие как hsa-mir-566 (45 копий EST и 56 копий SAGE), hsa-mir-619 (53 копии EST и 187 копий SAGE) и hsa-mir-1273 (195 копий EST). копии). Их высокая численность предполагает их функциональное значение в регуляции раннего кроветворения.

    Альтернативная транскрипция.

    Кодирующие последовательности известных генов в геномной ДНК имеют определенные структуры. Однако транскрипты, экспрессируемые геномными кодирующими последовательностями, могут существенно отличаться из-за регуляции транскрипции. Полученные в результате изоформы транскриптов существенно увеличивают сложность генома и могут привести к изменению биологической активности. Мы решили эту проблему, проанализировав дифференциальную инициацию транскрипции, альтернативный сплайсинг и аденилирование, а также антисмысловую и некодирующую транскрипцию.

    Альтернативная инициация транскрипции.

    Набор из 1090 5'-EST был получен из библиотеки кДНК CD34 + , кэпирующей олигонуклеотиды (CD34C, ссылка 16). Наша оценка этих последовательностей с помощью тегов экспрессии гена 5'-кэпа-анализа (CAGE) человека показывает, что 5'-концы 83% последовательностей отображаются на 5'-теги CAGE, подтверждая, что 5'-EST из этой библиотеки CD34 + предоставлять качественную и добросовестную информацию о 5 'концах. Всего 503 промотора для 495 генов были идентифицированы 1090 5'-EST, из которых 157 принадлежат генам с одним промотором, а 346 принадлежат генам с несколькими промоторами.Из 503 промоторов 333 являются TATA- CpG +, 52 - TATA + CpG +, 27 - TATA + CpG- и 91 - TATA- CpG- (таблица 3, набор данных S7 A ). Характер распределения соответствует таковому для большинства генов человека (25). IL2RA (альфа-субъединица рецептора интерлейкина-2) является геном, важным для регулируемой интерлейкином 2 пролиферации Т-клеток. Промотор этого гена, идентифицированный 5'-EST (DA419380), представляет собой TATA- CpG-. Широкое использование мультипромоторных генов с атипичной структурой промотора предполагает, что альтернативная инициация транскрипции обычно используется генами, экспрессируемыми в клетках CD34 + .

    Таблица 3.

    Экспрессия альтернативного гена в клетках CD34 +

    Альтернативный сплайсинг и аденилирование.

    Альтернативный сплайсинг и аденилирование - два механизма посттранскрипционной регуляции (26). 3'-EST расположен на 3'-конце обнаруженного транскрипта. Их 3'-концевое положение в отображенном RefSeq может использоваться для определения альтернативно сплайсированных и / или аденилированных транскриптов; Тег SAGE расположен на 3'-конце после последней CATG обнаруженного транскрипта.Тег SAGE, совпадающий с положением CATG выше по течению в RefSeq, подразумевает, что тег SAGE получен из альтернативно сплайсированного или аденилированного транскрипта. Отображение сигнала поли (A) + 3 'EST в RefSeq показывает, что 28% 3' EST совпадают перед 3'-концами (таблица 3, набор данных S7 B ). FTh2 (NM_002032) представляет собой пример. Из 7 EST, сопоставленных с его полноразмерной последовательностью из 1245 оснований, все соответствовали 297 основаниям перед 3'-концом. Отображение тегов SAGE показывает, что 50–73% тегов SAGE совпадают с расположениями в восходящем направлении (таблица 3, набор данных S7 C и D ).Например, из 5 тегов SAGE, соответствующих последовательности FOXK1 (NM_001037165), 4 совпадали вышестоящих сайтов CATG и 1 соответствовал 3'-концевому сайту CATG (набор данных S7 C ).

    Антисмысловые и некодирующие транскрипты.

    Антисмысловая транскрипция - это механизм регуляции экспрессии генов. Было показано, что до 70% генов человека экспрессируют антисмысловые транскрипты (27). Используя 7356 хорошо аннотированных антисмысловых последовательностей в качестве эталона, 25% картируются с помощью CD34 + EST и тегов SAGE (таблица 3, набор данных S8 A ).AA687703, антисмысловой транскрипт CSDE1 , был отображен с помощью EST, тега SAGE и тега longSAGE. Некодирующие транскрипты участвуют в регуляции экспрессии генов, редактировании РНК, геномном импринтинге и эпигенетической активности (32), а также в дифференцировке стволовых клеток (28). Из 2354 известных последовательностей некодирующих транскриптов 39% картируются с помощью CD34 + EST и тегов SAGE (таблица 3, набор данных S8 B ). Например, некодирующий xi-транскрипт AF001545 был обнаружен тегом SAGE и тегом longSAGE.

    CD34

    + Сигнатуры экспрессии специфичных для клеток генов.

    Отражая динамический процесс гемопоэтической дифференцировки, спектр транскриптома изменяется на разных этапах. Мы сравнили экспрессию генов между клетками CD34 + , вышележащими эмбриональными стволовыми клетками и нижележащими зрелыми гематопоэтическими клетками. Теги SAGE предоставляют как обширную, так и количественную информацию и использовались для сравнения. Результаты показывают, что клетки CD34 + действительно имеют специфические сигнатуры экспрессии, что отражается в различиях тысяч тегов SAGE между клетками CD34 + и другими типами клеток (таблица 4, набор данных S9).Подробное сравнение выявило набор основных генов, которые отличает клетки CD34 + от нескольких типов клеток, включая 220 генов, которые сильно или только обнаруживаются в клетках CD34 + , и 98 генов, которые сильно или только обнаруживаются в других типах клеток (Таблица 5, набор данных S9 В ). Функциональные категории этих генов охватывают широкий диапазон. Эти гены предоставляют новые гены-кандидаты, связанные с ранним гематопоэзом, и новые маркеры генов-кандидатов, специфичные для клеток CD34 + . HLA-DRA , ген MHC класса II, играет важную роль в презентации антигена в иммунной реакции.Однако самый высокий уровень экспрессии этого гена наблюдается в клетках CD34 + , но не в антигенпредставляющих типах клеток. XIST кодирует некодирующие транскрипты, которые заглушают одну из 2 X-хромосом посредством импринтинга X-хромосомы. Считается, что XIST активен только на ранних эмбриональных стадиях. Высокий уровень экспрессии множественных изоформ транскрипта XIST в клетках CD34 + , что отражено тремя разными тегами SAGE в 32, 13 и 10 копиях (набор данных S9 B ), поддерживает идею о том, что XIST повторно активируется в ранний гемопоэз (29).

    Таблица 4.

    Сигнатура экспрессии CD34-специфического гена: различия между клетками CD34 + и несколькими типами клеток *

    Таблица 5.

    Сигнатура экспрессии CD34-специфического гена: Примеры сигнатурных генов между клетками CD34 и несколькими типами клеток

    CD34

    + Карта транскрипции клеток.

    Мы разработали карту транскрипции клеток CD34 + , которая обеспечивает общий вид генома для транскрипционной активности в клетках CD34 + .Карта содержит подробную информацию о картировании, включая обнаруженные транскриптом CD34 + гены с их соответствующими экзонами, интронами, антисмысловыми, промоторными, 5'- и 3'-концами, а также межгенную область с картированием транскрипта CD34 + , представляющую новую транскрибируемую область. loci (набор данных S10). Карта интегрирована в браузер генома человека Калифорнийского университета в Санта-Крус (UCSC) и может быть визуализирована от всей хромосомы до уровней с одним основанием (http: //projects.bioinformatics.northwestern.edu/wanglab/CD34plus/). Выбирая элементы, перечисленные в браузере генома, можно выбрать информацию, относящуюся к отображенным транскриптам. Сравнивая общую информацию о транскрипции, отображаемую в браузере, карта транскрипции клеток CD34 + показывает общность и различия между известными транскрибируемыми локусами и CD34 + -специфическими транскрибируемыми локусами. На рис. 1 показана транскрипционная карта CD34 + хромосомы 21.

    Рисунок 1.

    CD34 + карта транскрипции клеток в хромосоме 21.( A ) Положения полноразмерных тегов кДНК, EST и longSAGE в 21 хромосоме hg18. RefSeq в нижней строке представляет известные гены человека. Карта интегрирована в браузер генома человека UCSC. ( B ) Увеличенное изображение картированных транскриптов в локусе, содержащем AML1 / RUNX1 , ген, важный для раннего гематопоэза. Из 5 EST, картированных с этим геном, 1 отображается на 3'-конец, но в антисмысловой ориентации, а 4 отображаются на первый интрон; из 17 отображенных тегов longSAGE 2 отображаются на 3'-конец и 15 отображаются на разные интроны, из которых 5 находятся в антисмысловой ориентации.

    Обсуждение

    В нашем исследовании использовались нормальные последовательности транскриптов CD34 + полноразмерных тегов кДНК, EST и SAGE, собранные системой секвенирования Сэнгера (30). Путем анализа интегрированных последовательностей транскрипта CD34 + с текущей информацией о геноме наше исследование дает всестороннее представление о транскриптоме CD34 + . Данные исследования показывают, что ранний гематопоэз - это организованный процесс, в котором задействовано более половины генов человека, и указывают на то, что для полного раскрытия генетической основы гематопоэза потребуются системные подходы.

    Для этого исследования необходимо рассмотреть два вопроса. Один из них - природа клеток CD34 + , а другой - полнота данных. Клетки CD34 + представляют собой не гомогенную, а гетерогенную популяцию, охватывающую стволовые клетки, более ранние мультипотентные предшественники и более поздние предшественники, ограниченные по клону. Используя более специфические маркеры, клетки CD34 + можно разделить на более узкие стадии дифференцировки. Хотя было бы идеально анализировать клетки на более конкретных стадиях, повышенная редкость таких клеток ограничивает их практическое использование для крупномасштабных исследований транскриптомов.Разработка новых подходов, таких как одноклеточные анализы для выделения транскриптов, и сбор последовательностей с использованием секвенсоров ДНК следующего поколения, которые требуют меньшего количества входного материала, чем секвенаторы Сэнгера, могут улучшить ситуацию. Как и исследования транскриптомов в большинстве типов клеток человека, наше текущее исследование не охватывает весь транскриптом CD34 + . Это иллюстрируется отсутствием определенных генов, которые, как известно, играют роль в раннем гематопоэзе. Например, несколько микроРНК участвуют в регуляции гематопоэза, но многие из них не включены в набор данных микроРНК из текущего исследования (23).Наше текущее исследование нацелено только на мРНК поли (A) + . Все больше данных показывает, что существуют различные типы транскриптов, такие как регуляторные малые РНК (31). Эти транскрипты не содержат поли (А) хвостов [поли (А) - ] (32) и не могут быть обнаружены подходом на основе поли (А) + . Кроме того, при заданном масштабе секвенирования некоторые функционально важные гены, экспрессируемые в более низком количестве, будут ниже порога обнаружения. Секвенсоры нового поколения обеспечивают гораздо более высокую пропускную способность.Их применение должно увеличить охват транскриптомом.

    Методы

    De Novo Коллекция CD34

    + 3 ′ EST.

    CD34 костного мозга + клеток 3 здоровых доноров были приобретены у AllCells. 3 'EST собирали с помощью метода GLGI (18, 19). Всего 10 000 тегов CD34 + SAGE, идентифицированных в предыдущем исследовании (12), были выбраны в качестве смысловых праймеров для реакций GLGI на основе следующих условий: i .Каждый тег должен соответствовать последовательностям генома человека. Это обеспечит минимальную гарантию того, что метка SAGE, вероятно, принадлежит транскриптам, экспрессируемым из генома человека. ii. Не должно быть трека поли (A) (> 7 последовательных A) на 200 п.н. ниже по течению от места, отображаемого тегом (33). Это ограничение поможет исключить теги SAGE из кДНК, генерируемой внутренним олиго (dT) примированием. iii. Он не должен картироваться с известными последовательностями мРНК человека. Это увеличит шанс идентифицировать новые расшифровки стенограммы.

    Источники существующих последовательностей транскриптов CD34 человека

    + и других типов клеток.

    Полноразмерные теги кДНК, EST и SAGE из нормальных человеческих клеток CD34 + были загружены из NCBI Entrez (http://www.ncbi.nim.nih.gov/Entrez). Данные SAGE для других типов клеток были загружены из NCBI GEO (http://www.ncbi.nim.nih.gov/geo). Статистическое сравнение данных SAGE проводили с использованием программы IDEG6 (http://telethon.bio.unipd.it/bioinfo/IDEG6/) при пороговом значении P <0.05 и кратное изменение ≥3 между наборами данных.

    Справочные базы данных, используемые для анализа.

    Последовательности мРНК RefSeq «ОБЗОР» и «ПОДТВЕРЖДЕНИЕ» были загружены с http://www.genome.ucsc.edu. База данных «SAGEmap надежная» была загружена с http://www.ncbi.nlm.nih.gov/projects/SAGE/. База данных Gene Ontology была загружена с http://www.geneontology.org/. Гены факторов транскрипции были загружены с http://dbd.mrc-lmb.cam.ac.uk/DBD/. Гены путей передачи сигнала были загружены с http: // www.genome.jp/kegg/pathway.html. Гены киназ были загружены с http://kinase.com/human/kinome/. Последовательности-предшественники микроРНК загружали из miRbase под «последовательностями шпильки» (http://microrna.sanger.ac.uk/sequences/). Для идентификации микроРНК, обнаруженных меткой SAGE, последовательности шпильки были расширены геномными последовательностями длиной 30 п.н. как на 5'-, так и на 3'-концах, чтобы увеличить вероятность обнаружения сайта CATG (27). Ссылочные теги SAGE затем были извлечены рядом с идентифицированными сайтами CATG. База данных CAGE была загружена с http: // gerg01.gsc.riken.jp/cage/hg17prmtr/. База данных сайтов начала транскрипции была загружена с http://dbtss.hgc.jp/. Антисены были загружены с http://natsdb.cbi.pku.edu.cn. Некодирующие транскрипты были загружены с http://research.imb.uq.edu.au/RNAdb.

    Определение альтернативного сплайсинга и аденилирования.

    Каждый 3'-EST был исследован на наличие сигнала поли (A) 10-30 оснований выше 3'-конца в порядке AATAAA, ATTAAA, TATAAA, AGTAAA, AAGAAA, AATATA, AATACA, CATAAA, GATAAA, AATGAA, TTTAAA, АКТААА, ААТАГА (26).3'-EST были картированы непосредственно с последовательностями мРНК RefSeq. 3'-EST, которые заканчивались в пределах ± 10 п.н. от картированных последовательностей RefSeq, были классифицированы как представляющие 3'-концы, а те, которые отображены дальше вверх по течению, были классифицированы как представляющие альтернативные сплайсированные последовательности. Для идентификации транскриптов с альтернативным сплайсингом, обнаруженных с помощью тегов SAGE, контрольные теги SAGE длиной 14 или 21 п.н. были извлечены после всех сайтов CATG в последовательностях RefSeq.

    Картирование генома.

    Полноразмерные последовательности кДНК и EST были сопоставлены непосредственно с hg18, а теги longSAGE были сопоставлены с эталонными тегами longSAGE, извлеченными из всех сайтов CATG в hg18.Картирование основано на хромосомах и интегрировано в браузер генома UCSC со всеми его выбираемыми функциями.

    Благодарности

    Мы благодарим Конни Дж. Ивз (BC Cancer Agency, Ванкувер, Британская Колумбия) за предоставленные данные тегов CD34 + LongSAGE. Мы ценим вдумчивые комментарии и критику Кеннета Болера и Масело Бенто Соареса. Это исследование было поддержано грантом R01HG002600 Национального института здравоохранения (S.M.W.), Фондом Дэниела Ф. и Ады Л. Райс (S.M.W.), премией развития карьеры от Северо-Западного научно-исследовательского института здравоохранения Эванстона (для S.M.W.), грантов Национального института здравоохранения R01 HG001696 (для M.Q.Z.) и CA84405 (для J.D.R.), а также Чикагского университета (J.D.R.).

    Сноски

    • 2 Кому может быть адресована корреспонденция. Электронная почта: jrowley {at} medicine.bsd.uchicago.edu или swang1 {at} northwestern.edu
    • Вклад авторов: M.Q.Z., J.D.R. и S.M.W. спланированное исследование; Ю.C.K., Q.W., J.C. и Y.-C.J. проведенное исследование; Y.C.K., Q.W., Z.X., M.Q.Z. и S.M.W. проанализированные данные; и J.D.R. и S.M.W. написал газету.

    • Конфликт интересов: авторы заявляют об отсутствии конфликта интересов.

    • Размещение данных: Данные 3 'EST, полученные в результате исследования, были депонированы в NCBI dbEST с номером доступа GD135551-161348. Информация о картировании генома приведена на http://projects.bioinformatics.northwestern.edu/wanglab/CD34plus.

    • Эта статья содержит вспомогательную информацию на сайте www.pnas.org/cgi/content/full/09033/DCSupplemental.

    Отобранные CD34 в сравнении с необработанной трансплантацией аутологичных гемопоэтических стволовых клеток при лечении тяжелого системного склероза: апостериорный анализ клинических испытаний фазы I / II, проведенных в Японии | Исследования и терапия артрита

  • 1.

    Габриэлли А., Авведименто Э.В., Криг Т. Склеродермия. N Engl J Med. 2009; 360: 1989–2003.

    CAS Статья Google ученый

  • 2.

    Дентон С.П., Ханна Д. Системный склероз. Ланцет. 2017; 390: 1685–99.

    Артикул Google ученый

  • 3.

    Фушиотти П. Современные взгляды на иммунопатогенез системного склероза. Immunotargets Ther. 2016; 5: 21–35.

    CAS Статья Google ученый

  • 4.

    Коваль-Белецкая О., Франсен Дж., Авуак Дж., Беккер М., Кулак А., Алланор Ю. и др. Обновление рекомендаций EULAR по лечению системного склероза. Ann Rheum Dis. 2017; 76: 1327–39.

    Артикул Google ученый

  • 5.

    Denton CP, Hughes M, Gak N, Vila J, Buch MH, Chakravarty K, et al. Рекомендации BSR и BHPR по лечению системного склероза. Ревматология (Оксфорд). 2016; 55: 1906–10.

    Артикул Google ученый

  • 6.

    Стин В.Д., Медсгер Т.А. Младший. Тяжелое поражение органов при системном склерозе с диффузной склеродермией. Ревматоидный артрит. 2000; 43: 2437–44.

    CAS Статья Google ученый

  • 7.

    Франсен Дж., Попа-Диакону Д., Хессельстранд Р., Каррейра П., Валентини Дж., Беретта Л. и др. Клинический прогноз 5-летней выживаемости при системном склерозе: проверка простой прогностической модели в центрах EUSTAR. Ann Rheum Dis. 2011; 70: 1788–92.

    CAS Статья Google ученый

  • 8.

    Келси П.Дж., Оливейра М.-С, Бадольо М., Шаррак Б., Фардж Д., Сноуден Д.А. Трансплантация гемопоэтических стволовых клеток при аутоиммунных заболеваниях: от фундаментальной науки к клинической практике. Curr Res Transl Med. 2016; 64: 71–82.

    CAS Статья Google ученый

  • 9.

    Бинкс М., Пассвег Ф.Д., МакСвини П., Салливан К., Безенталь С. и др. Испытание фазы I / II трансплантации аутологичных стволовых клеток при системном склерозе: смертность, связанная с процедурой, и влияние на кожные заболевания.Ann Rheum Dis. 2001; 60: 577–84.

    CAS Статья Google ученый

  • 10.

    Farge D, Passweg J, van Laar JM, Marjanovic Z, Besenthal C, Finke J, et al. Трансплантация аутологичных стволовых клеток в лечении системного склероза: отчет из реестра EBMT / EULAR. Ann Rheum Dis. 2004. 63: 974–81.

    CAS Статья Google ученый

  • 11.

    Ояма Ю., Барр В.Г., Статкуте Л., Корбридж Т., Э. а Г., Йованович Б. и др.Аутологичная трансплантация немиелоаблативных гемопоэтических стволовых клеток пациентам с системным склерозом. Пересадка костного мозга. 2007; 40: 549–55.

    CAS Статья Google ученый

  • 12.

    Нэш Р.А., Максуини П.А., Кроффорд Л.Дж., Абиди М., Чен С., Годвин Д.Д. и др. Высокодозная иммуносупрессивная терапия и трансплантация аутологичных гемопоэтических клеток при тяжелом системном склерозе: долгосрочное наблюдение за многоцентровым пилотным исследованием в США.Кровь. 2007; 110: 1388–96.

    CAS Статья Google ученый

  • 13.

    Vonk MC, Marjanovic Z, van den Hoogen FHJ, Zohar S, Schattenberg a VMB, Fibbe WE, et al. Результаты отдаленного наблюдения после трансплантации аутологичных гемопоэтических стволовых клеток при тяжелом системном склерозе. Ann Rheum Dis. 2008. 67: 98–104.

    CAS Статья Google ученый

  • 14.

    Мур Дж., Энглерт Х., Ферлонг Т., Пун Т., Милликен С., Ма Д.Ауто-ТГСК вызывает устойчивый ответ у пациентов с тяжелым системным склерозом, у которых отсутствует импульсный прием циклофосфамида. Пересадка костного мозга. 2012; 47: 1486–7.

    CAS Статья Google ученый

  • 15.

    Берт Р.К., Оливейра М.К., Шах С.Дж., Мораес Д.А., Симоес Б., Георгиад М. и др. Поражение сердца и связанная с лечением смертность после трансплантации немиелоаблативных гемопоэтических стволовых клеток с неотобранной аутологичной периферической кровью для пациентов с системным склерозом: ретроспективный анализ.Ланцет. 2013; 381: 1116–24.

    Артикул Google ученый

  • 16.

    Берт Р.К., Шах С.Дж., Дилл К., Грант Т., Георгиад М., Шредер Дж. И др. Сравнение аутологичной немиелоаблативной трансплантации гемопоэтических стволовых клеток с пульс-циклофосфамидом один раз в месяц при системном склерозе (ASSIST): открытое рандомизированное исследование фазы 2. Ланцет. 2011; 378: 498–506.

    CAS Статья Google ученый

  • 17.

    van Laar JM, Farge D, Sont JK, Naraghi K, Marjanovic Z, Larghero J, et al. Аутологичная трансплантация гемопоэтических стволовых клеток против внутривенного импульсного циклофосфамида при диффузном кожном системном склерозе. ДЖАМА. 2014; 311: 2490–8.

    Артикул Google ученый

  • 18.

    Салливан К.М., Гольдмунц Э.А., Киз-Эльштейн Л., МакСвини П.А., Пинкни А., Уэлч Б. и др. Миелоаблативная трансплантация аутологичных стволовых клеток при тяжелой склеродермии.N Engl J Med. 2018; 378: 35–47.

    Артикул Google ученый

  • 19.

    Берт Р.К., Фардж Д. Системный склероз: аутологичная ТГСК эффективна, но можем ли мы сделать ее более безопасной? Nat Rev Rheumatol. 2018; 14: 189–91.

    PubMed PubMed Central Google ученый

  • 20.

    Берт Р.К., Мармонт А., Ояма Ю., Славин С., Арнольд Р., Хиепе Ф. и др. Рандомизированные контролируемые испытания аутологичной трансплантации гемопоэтических стволовых клеток при аутоиммунных заболеваниях: эволюция от миелоаблативных схем к лимфоаблативным схемам трансплантации.Ревматоидный артрит. 2006; 54: 3750–60.

    Артикул Google ученый

  • 21.

    Сноуден Дж. А., Саккарди Р., Аллез М., Ардиццоне С., Арнольд Р., Сервера Р. и др. Гематопоэтическая СКТ при тяжелых аутоиммунных заболеваниях: обновленные рекомендации европейской группы по трансплантации крови и костного мозга. Пересадка костного мозга. 2012; 47: 770–90.

    CAS Статья Google ученый

  • 22.

    Цукамото Х., Нагафудзи К., Хориучи Т., Миямото Т., Аоки К., Такасе К. и др.Испытание фазы I-II аутологичной трансплантации стволовых клеток периферической крови при лечении рефрактерных аутоиммунных заболеваний. Ann Rheum Dis. 2006; 65: 508–14.

    CAS Статья Google ученый

  • 23.

    Цукамото Х., Нагафуджи К., Хориучи Т., Митома Х., Нииро Х., Аринобу Й. и др. Анализ восстановления иммунитета после трансплантации аутологичных CD34 + стволовых / клеток-предшественников при системном склерозе: преобладающее восстановление Th2 CD4 + Т-клеток.Ревматология. 2011; 50: 944–52.

    CAS Статья Google ученый

  • 24.

    Masi AT. Предварительные критерии классификации системного склероза (склеродермии). Ревматоидный артрит. 1980; 23: 581–90.

    Артикул Google ученый

  • 25.

    Медсгер Т.А. младший, Бомбардиери С., Цирджак Л., Скорца Р., Делла Росса А., Бенцивелли В. Оценка тяжести заболевания и прогноза.Clin Exp Rheumatol. 2003; 21: S42–6.

    PubMed Google ученый

  • 26.

    Мур Дж., Брукс П., Милликен С., Биггс Дж., Ма Д., Гендель М. и др. Пилотное рандомизированное исследование, сравнивающее трансплантацию отобранных CD34 и необработанных гемопоэтических стволовых клеток при тяжелом, рефрактерном ревматоидном артрите. Ревматоидный артрит. 2002; 46: 2301–9.

    CAS Статья Google ученый

  • 27.

    Oliveira MC, Labopin M, Henes J, Moore J, Del Papa N, Cras A, et al. Влияет ли положительный отбор ex vivo на CD34 + на исход после трансплантации аутологичных гемопоэтических стволовых клеток пациентам с системным склерозом? Пересадка костного мозга. 2016; 51: 501–5.

    CAS Статья Google ученый

  • 28.

    Arruda LCM, Clave E, Moins-Teisserenc H, Douay C, Farge D, Toubert A. Сброс иммунного ответа после трансплантации аутологичных гемопоэтических стволовых клеток при аутоиммунных заболеваниях.Curr Res Transl Med. 2016; 64: 107–13.

    CAS Статья Google ученый

  • 29.
  • Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *